KEGG   Xenopus tropicalis (western clawed frog): 100492311Help
Entry
100492311         CDS       T01011                                 

Definition
clathrin heavy chain 1-like
Orthology
K04646  
clathrin heavy chain
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Lysosome
Endocytosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100492311
   04142 Lysosome
    100492311
Exosome [BR:xtr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100492311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1680 aa AA seqDB search
MAQILPIRFQEHMQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMAEPNS
PLRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMSEEVIFWKWISVNTVA
LVTETAVYHWSMEGDSQPQKMFDRHASLAGCQIINYRTDEQQKWLLLIGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKIERNSKPSTLFCFAVRGQAGGKLHIIEVGQPANGN
QPFAKKAVDVFFPPEAQTDFPVAMQIGSKHGVIYLITKYGYIHMYDLESGACIYMNRISA
DTIFVTAPYEPTSGIIGVNKKGQVLSVCVEEENIVNYATSVLQNPDLGLRMAVRSNLPGA
EELFARKFNTMFAQGNYSEAAKVAASAPKGILRTAETIRKIQAVPAQPGQASPLLQYFGI
LLDQGQLNKLESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKTVDPTLALSVYL
RANVPNKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRSVMRISPDQGLQFAQMLVQDE
EPLANINQIVDVFMENSLIQQCTSFLLDALKNNRPSEGHLQTRLLEMNLIHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNAEWLVNFFGSLSV
EDSVECLRAMLSANIRQNLQLSVQVASKYHEQLGTQSLVELFESFKSYEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRIPAVVGGLLDVDCSEDVIKNLIMVVHGQF
STDELVAEVEKRNRLKLLLPWLESRIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSCVVGKYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVRRKDAELWANVL
EENNPFRRQLIDQVVQTALSETQDPEEVSVTVKAFMTAELPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNQLFEEAFAIFRKFDVNTS
AIQVLIEHIGNLDRAYEFAERCNESAVWSQLGRAQLQKDLVKEAIDSYIKADDPSSYMEV
VQAASRNSNWEDLVKFLQMARKKARESFVETELIFALAKTNRLSELEEFVSGPNNAHIQQ
VGDRCYEEGMYDAAKLLYNNVSNFARLASTLVHLGEYQAAVDSARKANSTRTWKEVCFAC
VDGTEFRLAQMCGLHIVIHADELEELISYYQDRGYFEELIALLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWGELVFLYDKYEEYDNAIITMMN
HPTSAWKEGQFKDIVTKVANVELYYKALQFYMEYKPLLINDLLIVLSPRLDHTRTVNYFF
KVNQLPLVKPYLRSVQNHNNKSVNEALNNLLTEEEDYQGLRASIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLYKGNNRWKQSVELCKKDRLYKDAMLYAAESKDTDLAENLLQWFLEE
GKQECFAATLFTCYDLLHADIVLELAWRHHIMDFAMPYFIQVMREYLTKVDKLHAAESLR
KEAEQVTEPTPIVFGQQLMLTAGPSGVVPPQPNFPYGYAAPTNFTQPPPPSVSPGYGFNM
NT seq 5043 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatattgcctatccggtttcaggagcacatgcagctccagaatctggggatc
aatccagccaacattggttttagcacacttaccatggaatcggataagtttatctgcatc
cgggagaaggttggagaacaggcacaggtggttatcatagatatggctgagccaaacagc
ccactgagacgccctatctcagctgaaagtgctataatgaaccctgcctccaaagttata
gcattgaaagctgggaaaactcttcagatttttaacatagaaatgaagagcaaaatgaaa
gctcatactatgtccgaagaggtcatcttctggaagtggatatccgtcaacactgttgcc
ctggtgacagagacagcagtttaccactggagcatggagggtgactcccagcctcagaaa
atgtttgatcgccatgccagtcttgctggttgccagattatcaactataggactgatgaa
caacaaaaatggcttctcttgatcggtatctctgctcagcaaaacagagtggtgggtgca
atgcagctctactctgtagacagaaaagtctcacagcccatagaagggcatgctgctgca
tttgccgaatttaagattgaaagaaactcaaagccttccacacttttctgctttgctgtt
cgtgggcaggcaggaggcaagttgcacatcatagaagttggacagcctgccaatgggaac
cagccttttgccaagaaagctgttgatgtgttctttccccctgaggctcagactgacttc
cccgtggctatgcagattgggtctaagcatggagtaatctatttaatcacaaagtatggc
tacatccacatgtatgacctggagtctggagcctgtatctatatgaatcgtatcagtgct
gacaccatctttgttacagctccttatgaacccacctcaggaatcattggggttaataag
aaaggacaggtgctctctgtctgtgtggaagaagaaaatattgtgaattatgccaccagt
gtactacaaaacccagacctgggtttgcgcatggctgttcgcagtaacctcccaggggct
gaagaactttttgcaaggaaatttaacacaatgttcgcccaagggaactattcagaggca
gctaaagtagcagcatctgccccaaagggaattttgcgtacggctgaaaccatcagaaag
atccaggcagtgccagctcagcctggacaggcttctcccctgctccagtattttggcatt
ctactcgatcaggggcagctgaacaagctagaatcgctagagctctgcaggccagtcttg
caacagggccgtaagcagctcttagagaagtggttaaaagaagataagcttgaatgttct
gaggagcttggggacttggtgaagactgtagatccaactcttgctctgagtgtttatctg
cgtgccaatgtgccaaacaaagtgatacagtgctttgcagaaacagggcagttccagaaa
attgtactttatgctaaaaaggttggttacaccccagactggattttcctccttcgtagt
gtaatgcggatcagtccagaccaggggctgcaatttgcacagatgcttgttcaggacgaa
gagccacttgcaaatatcaaccaaattgtggatgtcttcatggagaacagtctgatccag
cagtgcacttcattcctgcttgatgctctcaaaaacaatagaccatctgaaggccacctc
cagactcggcttctagagatgaatttgatccatgctccacaggtagcagatgcaatcctg
gggaaccagatgtttacccattatgatcgagcccacattgcccagctgtgtgaaaaagct
ggactactgcaaagagctctggagcattacacagatctttatgacattaaacgggccgtg
gtgcatacacaccttctgaacgcagaatggctggtgaatttttttggctcactatcagtg
gaagattctgttgagtgccttcgagccatgctgtctgccaacattcgccagaacctacaa
cttagtgttcaagtggcatctaagtaccatgagcaacttgggacccagtcattggttgag
ctttttgagtcattcaagagttatgaaggtcttttctactttctgggatcaattgtcaat
ttcagccaagatcctgatgttcactttaagtacatccaggcagcctgcaaaacagggcaa
ataaaagaagttgaacggatatgcagggagagcaactgctataacccagagcgagtcaaa
aattttctgaaggaggctaaactcacagatcagcttccactgattattgtctgtgaccgt
tttgattttgtccatgacttggtcctgtatctgtaccgtaacaacctccagaagtacatt
gaaatttacgtgcagaaggtaaaccccagccgtatcccagctgtagtgggagggcttctg
gatgtagattgttctgaagatgtaataaaaaatctgataatggtggttcacgggcagttc
tctactgatgaattagtagcagaagtggagaaaagaaacaggttgaaattacttctgcct
tggctggaatcccgaatccatgaggggtgtgaggaaccagctacacataatgccctagca
aaaatctatattgacagcaataacaacccagaacgcttccttcgtgaaaacccctactat
gacagctgtgttgtgggcaagtactgtgaaaaaagagaccctcaccttgcctgtgtggca
tatgagagaggccaatgtgaccttgagctcattaaggtgtgcaatgaaaactccttgttc
aagagtgaggcccgttaccttgtacgtagaaaagatgcggaactgtgggcaaatgtccta
gaagaaaacaatccattcaggagacaattgattgatcaggtggtgcagactgctttgtca
gagacacaagacccagaagaagtgtcagtgactgtgaaggcgttcatgactgctgaactc
cccaatgagctgattgagcttctggagaaaatagtgctggataattcagttttcagtgag
cacagaaacttgcaaaatctcctcattttgacagcaattaaagctgaccgaactagagtg
atggaatacatcaaccgtttagataattatgatgcacctgatattgctaatatagctatc
agcaaccagctttttgaggaagcttttgccatattcaggaagtttgatgtgaacacatct
gcaatacaagttttgattgaacacatagggaatttggaccgtgcatatgaatttgctgag
aggtgtaatgagtcagctgtatggagtcagttgggccgagctcagctccagaaggatctc
gttaaagaagctatagactcttatatcaaagccgacgatccttcatcttatatggaagtt
gtacaggctgctagtaggaacagtaactgggaagacttggttaaattcttgcagatggca
aggaagaaggccagagaatcttttgtagagactgaacttatttttgcactggcgaaaaca
aatcgtctctctgagcttgaggagtttgtcagtggccccaacaatgcccacattcagcag
gtgggagaccgctgttatgaagaaggcatgtatgatgctgccaagctgctctataataat
gtttctaactttgctcgtttggcatctacattggtacatcttggggaatatcaggctgct
gtggatagtgcaagaaaagccaatagcacccgcacttggaaggaggtctgttttgcttgt
gtcgatggaacagagttccgcctggctcaaatgtgtggcctgcacattgtgattcatgca
gatgagcttgaagagctaatcagttattaccaggatcgtggatattttgaggagctaatt
gctctactagaagcagcattgggtttggagcgagcccacatgggaatgttcactgaactc
gccattctgtactcaaagtttaagcctcagaagatgcgggagcatctagagcttttctgg
tcacgtgttaatattcccaaggtactgcgggcagctgagcaggcccacctctggggtgaa
ctggtctttttatatgataaatatgaagaatatgataatgccattatcaccatgatgaac
catccaaccagcgcctggaaggaaggacaatttaaggatattgttaccaaggttgccaat
gttgagctgtattacaaagctttgcagttttacatggagtacaaacctcttttaatcaac
gacctcctcatagtattatctccacgtctagaccacactcggacggtcaactattttttt
aaggtcaatcagctgcccttggttaagccgtacctccgctcagtgcaaaaccacaataac
aagtcagtaaatgaggctctcaataatctactgactgaagaggaggattatcagggtctg
agagcatccatcgatgcatatgataactttgataacatcagtctagcccagcgactggag
aaacatgagctgattgaatttcgcagaattgcagcttatctgtacaagggaaacaaccgt
tggaagcagagtgtagaactgtgcaaaaaggatcgactgtataaggatgccatgctgtat
gctgcggaatcaaaggatactgacctggctgaaaatctgttacagtggtttttggaagaa
gggaagcaggagtgttttgccgccactctgtttacctgttatgacttgctgcatgcagat
attgtgctcgaacttgcctggagacaccatattatggattttgctatgccttatttcatc
caggtcatgagggaatatcttactaaggtggacaagctgcatgctgcagagagtttgagg
aaggaagccgaacaggtaacagaacctaccccaattgttttcggtcagcaactgatgctt
acagctggtcctagtggtgtggtgccacctcagcccaacttcccctatggatatgctgcc
cccactaacttcacccagcctcctccaccctctgtctctcctggctatggctttaacatg
taa

DBGET integrated database retrieval system