KEGG   Xenopus tropicalis (western clawed frog): 100492386Help
Entry
100492386         CDS       T01011                                 

Gene name
usp28
Definition
ubiquitin specific peptidase 28
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1104 aa AA seqDB search
MLLNQLREITGIQDSALLYEALKASNNDLTQAVGILTESVNEPATREVAFELSDTGGNAT
DKQVSVKSVPMHNKEVLQTTVAPSLQKDTGHQLNAVQCGRSSESQDSESKGRTKRKRCEV
WGDNPNRNDLRRIEDWPVGLKNIGNTCWFSAVIQSLFHLPEFRRLVHSYSITQSMLEKCQ
SRDEKRNLAFMQELQCLFTLMVGSNRKFVDPSPALELLKDAFLSEEAQQQDVSEFTHKLL
DWLEDAFQLTVNGEDPRDKSENPMVQLFYGTFLNEGFLEANKAFSNIETFGQYPLQVNGF
SNLNECLEAAMVEGEIENMQTAQSARYRQERWFTKLPPVLTFELSRFEFNQSLGQPEKIH
NKLEFPEIIYMDRFMYKNKELMRRKHSETRRLKGCIDHLNQKLESYLKYGSGPNRCPLPD
MLQYVLEFANTKSAEWCPPTEVVTTSQSATGSTGSLDAQPLQNGFVGNNDTETSNDDSPK
CESTSSLPPFVGHTVPNDCIPAEDPTHGSDTLEEIRSVAACLQRWRTEVEKDIQDLKDSI
ASCTKSIEEVFIDQDLSQVPYRLHAVLVHEGQANAGHYWAYIYSHSRCCWLKYNDVSVTE
ANWEELVRDSYGGMRNASAYCLMYINNKLPYLIADHEGELDDKINALHPALQCYVQEDNQ
RFDQEMTEWEEAHSCKIPQIESVGSSESVDHPSRNNASLCCEECSRSLSSEHAMIAKEQT
ALAITKTAESYERNGVEVALKEPTKPETGEASLSDASLTAQEETEPQPSSQLSEVEIPSV
GKILVRTDTDGYNEEMMLCPAMQGVIFAILKARQVFDRDGPEAGLVKAFHEEYSRLYQLS
KEEPSPSSDPRLQHVLIYFFQNKAPDRVIERTLLEQFADKNLSYNERSISIMKVAQAKLR
EIGPDDMDMKEYQKWHEDYSLFRKVSVYLLTGLELYQNEKWQEALTYLVYAYQCNRSLVS
SGESLGVEETLIQLYRRKCLLKLNDKAATLFESSQEEQVSEGISIMNDLIIPCMHLIFNN
KISEEDLSAIEEMRNRWCSYLGQDIDDNLQMKLGQFLPRLLDCSSDLIVLKEPPKIRPHS
PFDLCNRFTAIMESIQGASTVTVT
NT seq 3315 nt NT seq  +upstreamnt  +downstreamnt
atgcttctaaaccagctgagagagattactggtattcaggattcagctttattgtacgaa
gcacttaaggctagcaacaatgatcttactcaggctgttggaatccttactgagagtgtc
aatgagccagccacaagagaagtagcttttgagctgtctgacacaggaggcaatgcaaca
gacaaacaagtatctgttaagtctgtgcctatgcataataaagaggtgctccagacaact
gttgctcccagcttacagaaggacacaggccaccagttaaatgctgtacaatgtgggaga
tcttctgagtcccaagattctgaaagtaaaggccgtacaaagagaaaacgctgtgaagtt
tggggggataatcccaatcgcaatgatctgaggaggattgaagactggcctgtaggacta
aagaatattgggaacacctgttggtttagtgctgttatacagtcccttttccacctgcct
gaatttcgaaggcttgtccacagttacagcattacccagagcatgcttgaaaagtgccaa
agtcgtgatgagaaaaggaaccttgctttcatgcaggaactacagtgcctttttacctta
atggttggatcaaaccgaaagtttgtggatccttctcccgccctagaactgctgaaagat
gcatttttatcagaagaagcacagcagcaagatgtcagcgagtttacacataaacttctt
gactggctggaagatgctttccaactgaccgttaatggagaggacccaagagataaatca
gaaaatccaatggtacaacttttttatggcacatttcttaatgaaggatttcttgaagca
aataaagccttctccaacattgagacttttggtcagtacccactccaagttaatggtttc
agtaacctaaatgagtgtttggaagctgctatggtggaaggagaaattgaaaatatgcaa
actgcccaatctgcgaggtacaggcaagagcgctggtttacaaaacttcctcctgtatta
acgtttgagctttctcggtttgaatttaaccagtccttggggcagcctgaaaagattcac
aataaacttgaattcccagaaattatttacatggataggtttatgtacaaaaacaaagag
cttatgagaaggaagcacagtgaaacaaggaggctgaaaggttgcattgaccacttaaat
cagaagcttgaaagttacttgaaatatggctctgggcccaataggtgtccacttcctgat
atgttgcaatatgttcttgaatttgccaacacgaagtctgcagaatggtgccctccgact
gaagtggttacaacctcacagtctgcaacaggaagcactggttctttggatgcacaacct
ttacaaaatggctttgtaggtaataatgacactgaaacatctaatgatgacagccctaaa
tgtgaaagcacttcctcattgcctccatttgtggggcatactgtaccaaatgactgcatc
cccgcagaggatcctacacatgggtctgatactttagaggaaatccgatctgtggctgcc
tgcttacagagatggagaactgaggtggagaaagatattcaagacttgaaggattctatt
gcgagctgtacaaagtctattgaagaagtatttattgatcaagatttatctcaggtgccg
tacagactacatgcagtattagtccacgagggtcaggcaaatgctggacattactgggct
tacatctatagtcatagcaggtgttgctggttgaagtacaatgatgtgtctgtgactgaa
gctaattgggaggagcttgtaagagattcttacggtgggatgagaaatgccagtgcatac
tgtcttatgtacattaataataagctgccatacctcattgctgaccatgaaggggagctg
gatgataagatcaatgctctccatcctgcattgcaatgttatgtccaagaggataatcag
aggtttgaccaagaaatgacagagtgggaagaagcacactcctgcaaaattcctcagata
gaaagtgtgggatcctcagaatctgtggatcacccctcacgtaacaatgcatctttgtgc
tgtgaagaatgttccaggtctttatcttcagaacatgccatgattgctaaagaacaaaca
gccctcgctattaccaaaactgctgagtcctatgaaagaaatggagtggaagttgcccta
aaagagccaactaaacctgagacaggggaggccagcctttctgatgccagcctcacagct
caggaggaaacggagccacaacccagctcccagctttcagaagtggagatccccagtgtg
ggaaagatactcgttagaactgatactgatggctataatgaggagatgatgctctgccct
gccatgcaaggtgtaatctttgcaatactgaaagcccggcaggtatttgatcgagatggc
cctgaagctggccttgttaaggcatttcatgaggaatattctcggctttaccagctttct
aaagaagagccttctccatctagtgaccctcgtctgcagcatgttctcatttacttcttc
cagaacaaagccccagaccgggtgattgaacgaactttgcttgagcagtttgctgataaa
aacctcagctataatgaaagatcaattagcatcatgaaggttgctcaagcaaaactcaga
gagattgggccagatgatatggacatgaaagaataccagaaatggcatgaagactacagc
ctgtttcgtaaggtgtctgtttaccttctgactgggttggagctttatcagaatgaaaaa
tggcaggaagccctcacttaccttgtatatgcctatcagtgtaaccgttcgcttgtgagt
tcaggggaaagtcttggtgtagaggagaccttgattcagctctacagaaggaaatgccta
ctgaagcttaatgataaggctgccaccttgttcgagagcagccaagaagaacaggtctca
gaagggattagcattatgaatgacctgatcattccgtgcatgcatctaatattcaacaac
aaaatctctgaggaagacctttctgccattgaggagatgaggaatagatggtgttcttat
cttgggcaagatattgatgataatctgcaaatgaagctaggacagttccttcctagactg
cttgactgctccagtgacctcattgtgttaaaggaacctccaaagatccggccacattct
ccatttgatctgtgcaatcgtttcacagccatcatggagtccatacagggagcatccact
gtcactgtaacatag

DBGET integrated database retrieval system