KEGG   Xenopus tropicalis (western clawed frog): 100492698Help
Entry
100492698         CDS       T01011                                 

Definition
(RefSeq) phospholipase B1, membrane-associated-like
  KO
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100492698
   00565 Ether lipid metabolism
    100492698
   00590 Arachidonic acid metabolism
    100492698
   00591 Linoleic acid metabolism
    100492698
   00592 alpha-Linolenic acid metabolism
    100492698
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100492698
    3.1.1.5  lysophospholipase
     100492698
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 713 aa AA seqDB search
MFMVVQVQIPLFICCSIGGDSTLDRVTTLPNILLEFNPLLTGFSTGTGNKTLHNSYLNEA
VPGAKAFNLPEQVKDLIAQMKEDRRINYNNDWKVITILIGPNDLCSSCSDANFYSTKNFI
DYIQEALDLLHKEVPRAFVNLVEVMDIYPLREAVLDPRVKCPVLITKMLCPCLLNIADNS
QELKIVREFNSGYQRNTQQLIDTGRYDTKDDFTVVLQPFFRNPKIPSLPNGTPDSSFMAP
DCFHLSQKSHSQMARMLWKNMLEPVGMKTDILDFAAAETLTCPTPDQPFLRTYKNSNYNY
TPAQPTQPPIKNWGSDLTCQATGPSSQVPTSVHKLRPADIKVVAALGDSLTAAFGAKSSS
IAELGTEYRGVSWSIGGDGTLEECTTLPNILKKFNPNIKGFSTGVGRENEMFNVAISGAK
AENMASQATNLVNKMKESTVINFNEDWKVITIFIGGNDLCQFCHNRDRYSVHKHVSHIKN
TLDILYKEIPRVFVNLVEILEVEGLRRVNANTFGCTLLRPNLCPCFINPREGSPELYEMK
RFNKDLQSQVTALADKYQDREDFAVVVQPFFKNSVLPVDKNGDVDISFFSVDCFHFTERG
QSEMAKALWNSMLEPVGQKQEYNNFTNDRSNLKCPTQDKPYLFTLKNSGLPEPPETVVPV
PEEEEGQVPYWSVIVGTIGGCAVGCAIVGIAMSMTYKKKMRKMRSLTQSNSSF
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgttcatggttgtacaagtacaaattcctctatttatctgttgcagcattggtggtgat
tctaccttagaccgtgttactaccctaccaaatatactgcttgagttcaacccactgctc
actggattttcgaccgggacagggaacaaaactcttcataattcctatctgaatgaagct
gttcctggagccaaggcctttaatttaccagaacaagtaaaggacctgattgctcaaatg
aaagaagacaggagaatcaattacaataatgactggaaagtgatcactatattaattgga
cctaatgacttgtgttcttcgtgctcagatgctaacttttattccaccaaaaactttatc
gattacattcaagaggcgctggacctgttgcacaaggaggtccctagagcgtttgttaac
ctggtggaagtgatggatatctaccccctgagagaagctgttttggacccacgagtgaag
tgcccggtgcttattactaagatgctctgcccctgcctgctaaacattgccgacaactca
caggaactgaagatcgtacgggaatttaacagcggctatcagcgcaacacccagcagtta
attgacacgggaaggtacgacacaaaagatgactttactgtggttctgcagccattcttc
cgcaaccccaaaattcccagtctcccgaatgggaccccggattcatcgttcatggccccc
gactgttttcacctcagtcagaagtctcattcacagatggccaggatgctttggaaaaat
atgcttgaaccagttggaatgaaaacagatatattagactttgcagctgctgagacgctg
acctgccccaccccggatcagccgttcctaaggacatacaaaaacagcaattacaattat
acccctgcacagcccacccagccccctataaagaactggggcagtgacctgacatgccag
gcaaccggaccttcctcccaagtcccaacatcagtgcacaagttacgcccagctgacatc
aaggtggtagcggcccttggggactccctgaccgcagcgtttggcgctaagtcatcttca
atcgctgaattggggactgagtatcggggggtttcttggagcattggcggcgatgggacc
ctggaggaatgcaccactctgcccaatattttgaagaaatttaatccaaacataaaggga
ttttccactggagtcggcagagagaacgaaatgtttaatgtagccattagtggggccaaa
gcagaaaatatggcttctcaagcaaccaacctagtgaataagatgaaagaaagcaccgtg
atcaattttaatgaagactggaaggttatcaccatttttattggcggcaacgacctctgc
cagttttgccacaacagggacagatattccgtgcacaaacacgtcagccatattaaaaac
actttggacatcttatacaaagagattcctcgcgtttttgtgaatttggtggaaattctg
gaggtggaagggctgcgcagagtaaatgcaaacacttttggctgcaccctgctaaggccg
aacctttgtccgtgtttcattaacccacgggaaggctccccggagctgtatgaaatgaaa
aggtttaacaaggacctacagagccaagtcacggcattggctgacaaataccaggaccgg
gaagacttcgctgtcgtggtgcaaccatttttcaaaaacagcgttttgcctgttgataag
aacggcgatgtcgatataagcttcttttccgtggattgcttccatttcaccgagagaggc
cagtcagagatggccaaggccctgtggaacagcatgctggaacccgttggacaaaaacag
gaatacaataatttcaccaacgatcgatcaaatctgaaatgccctacgcaggacaagcct
tatctcttcaccctgaaaaacagtgggctccctgaaccccctgaaactgttgttcccgtg
ccagaggaagaagaaggccaggtgccctactggtcagtgatagtgggcaccattggcgga
tgtgctgtagggtgtgcgattgtcggcatcgcaatgtccatgacgtataaaaagaagatg
cgcaagatgcgatcactaacacaaagcaattcttccttctga

DBGET integrated database retrieval system