KEGG   Xenopus tropicalis (western clawed frog): 100492698Help
Entry
100492698         CDS       T01011                                 

Definition
phospholipase B1, membrane-associated-like
Orthology
K14621  
phospholipase B1, membrane-associated [EC:3.1.1.4 3.1.1.5]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:xtr00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:xtr00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:xtr00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:xtr00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:xtr00592]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 634 aa AA seqDB search
MKEDRRINYNNDWKVITILIGPNDLCSSCSDANFYSTKNFIDYIQEALDLLHKEVPRAFV
NLVEVMDIYPLREAVLDPRVKCPVLITKMLCPCLLNIADNSQELKIVREFNSGYQRNTQQ
LIDTGRYDTKDDFTVVLQPFFRNPKIPSLPNGTPDSSFMAPDCFHLSQKSHSQMARMLWK
NMLEPVGMKTDILDFAAAETLTCPTPDQPFLRTYKNSNYNYTPAQPTQPPIKNWGSDLTC
QATGPSSQVPTSVHKLRPADIKVVAALGDSLTAAFGAKSSSIAELGTEYRGVSWSIGGDG
TLEECTTLPNILKKFNPNIKGFSTGVGRENEMFNVAISGAKAENMASQATNLVNKMKEST
VINFNEDWKVITIFIGGNDLCQFCHNRDRYSVHKHVSHIKNTLDILYKEIPRVFVNLVEI
LEVEGLRRVNANTFGCTLLRPNLCPCFINPREGSPELYEMKRFNKDLQSQVTALADKYQD
REDFAVVVQPFFKNSVLPVDKNGDVDISFFSVDCFHFTERGQSEMAKALWNSMLEPVGQK
QEYNNFTNDRSNLKCPTQDKPYLFTLKNSGLPEPPETVVPVPEEEEGQVPYWSVIVGTIG
GCAVGCAIVGIAMSMTYKKKMRKMRSLTQSNSSF
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagacaggagaatcaattacaataatgactggaaagtgatcactatattaatt
ggacctaatgacttgtgttcttcgtgctcagatgctaacttttattccaccaaaaacttt
atcgattacattcaagaggcgctggacctgttgcacaaggaggtccctagagcgtttgtt
aacctggtggaagtgatggatatctaccccctgagagaagctgttttggacccacgagtg
aagtgcccggtgcttattactaagatgctctgcccctgcctgctaaacattgccgacaac
tcacaggaactgaagatcgtacgggaatttaacagcggctatcagcgcaacacccagcag
ttaattgacacgggaaggtacgacacaaaagatgactttactgtggttctgcagccattc
ttccgcaaccccaaaattcccagtctcccgaatgggaccccggattcatcgttcatggcc
cccgactgttttcacctcagtcagaagtctcattcacagatggccaggatgctttggaaa
aatatgcttgaaccagttggaatgaaaacagatatattagactttgcagctgctgagacg
ctgacctgccccaccccggatcagccgttcctaaggacatacaaaaacagcaattacaat
tatacccctgcacagcccacccagccccctataaagaactggggcagtgacctgacatgc
caggcaaccggaccttcctcccaagtcccaacatcagtgcacaagttacgcccagctgac
atcaaggtggtagcggcccttggggactccctgaccgcagcgtttggcgctaagtcatct
tcaatcgctgaattggggactgagtatcggggggtttcttggagcattggcggcgatggg
accctggaggaatgcaccactctgcccaatattttgaagaaatttaatccaaacataaag
ggattttccactggagtcggcagagagaacgaaatgtttaatgtagccattagtggggcc
aaagcagaaaatatggcttctcaagcaaccaacctagtgaataagatgaaagaaagcacc
gtgatcaattttaatgaagactggaaggttatcaccatttttattggcggcaacgacctc
tgccagttttgccacaacagggacagatattccgtgcacaaacacgtcagccatattaaa
aacactttggacatcttatacaaagagattcctcgcgtttttgtgaatttggtggaaatt
ctggaggtggaagggctgcgcagagtaaatgcaaacacttttggctgcaccctgctaagg
ccgaacctttgtccgtgtttcattaacccacgggaaggctccccggagctgtatgaaatg
aaaaggtttaacaaggacctacagagccaagtcacggcattggctgacaaataccaggac
cgggaagacttcgctgtcgtggtgcaaccatttttcaaaaacagcgttttgcctgttgat
aagaacggcgatgtcgatataagcttcttttccgtggattgcttccatttcaccgagaga
ggccagtcagagatggccaaggccctgtggaacagcatgctggaacccgttggacaaaaa
caggaatacaataatttcaccaacgatcgatcaaatctgaaatgccctacgcaggacaag
ccttatctcttcaccctgaaaaacagtgggctccctgaaccccctgaaactgttgttccc
gtgccagaggaagaagaaggccaggtgccctactggtcagtgatagtgggcaccattggc
ggatgtgctgtagggtgtgcgattgtcggcatcgcaatgtccatgacgtataaaaagaag
atgcgcaagatgcgatcactaacacaaagcaattcttccttctga

DBGET integrated database retrieval system