KEGG   Xenopus tropicalis (western clawed frog): 100492735Help
Entry
100492735         CDS       T01011                                 

Gene name
kat2a
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100492735 (kat2a)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100492735 (kat2a)
Transcription machinery [BR:xtr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100492735 (kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 769 aa AA seqDB search
MAELVQASQSRTSLQAPAAGHTATGTGGGSSSSTSDPARPGLSQQQRASQRKAQVRALPR
AKKLEKLGXFSACKVQGTHASVCFLAANHVSHLENVSEDEINRLLGMVVDVENLFMSVHK
EEDTDTKQVYFYLFKLLRKCILQMIRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLQP
KERQTMYELSKMFLLCLNYWKLETPSQFRQRSQNEDVATYKVNYTRWLCYCHVPQSCDSL
PRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIY
GENSPIWEADFTVPTTEGAQLVSRPAAVNTTSVPSTPLFNNNLNNSSSLSSSGDTSSSEP
MPGEKRKLSDSLTLEDAKRIRVMGDIPMELVNEVMLTITDPAAMLGPDTSLLSANAARDE
TARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKH
KTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNIL
YFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHII
KKQKEIIKKLIERRHAQIRKVYPGLTCFKEGLRQIPVECIPGIRETGWKPACKDKGKEIK
DPDQLYNILKNLLAQIKTHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLKNRYYV
TKKIFIADLQRIITNCREYNPPDSDYCKCANTLEKFFYFKLKEAGLIDK
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacttgtgcaggcctcgcagtcccgtactagcttgcaggctccggctgctggg
cacactgctaccgggacgggcggagggagcagctccagcactagcgacccggccaggccc
ggcctcagccagcagcagcgagccagtcagaggaaggcacaagtccgcgccctccctagg
gccaagaagctggaaaagctcggtngattctccgcttgtaaggtacagggaacgcacgct
tctgtctgctttcttgcagccaaccatgtgtctcacctggagaacgtttctgaagatgaa
atcaaccggctgctgggtatggtggtggacgtagaaaatctcttcatgtccgttcacaaa
gaggaagacacagacaccaagcaagtttacttttacttgtttaagctgctaaggaagtgt
atccttcagatgatccggccagtggtagagggatctttgggaagcccaccatttgaaaag
ccaaatatagaacagggcgtcctgaattttgtccagtacaagttcagccatctgcagcct
aaggaacgtcaaactatgtatgagctgtccaaaatgttcctcctgtgcttaaattactgg
aagcttgaaactccttcacagttccgtcagagatcacagaatgaggatgtagcgacatac
aaggttaattataccaggtggctctgttactgccacgtaccacagagctgtgacagcctg
ccacgctatgaaactacacatgtgtttgggaggagtctgctccgttccatcttcactgtt
acccggagacaactgctggagaagttcagggtggagaaggacaagcttgttcccgagaag
cggactcttatccttacacacttcccaaagttcctctccatgctggaagaagaaatctat
ggtgaaaactcacccatctgggaggcagattttactgttccaaccacagaaggtgcccaa
ctagtgtctcgtccagctgctgtcaacactacttcagtcccctctactcctctcttcaac
aacaatctaaacaacagttcttctctctcgtccagtggggacactagcagttcagaacca
atgccaggtgagaaaaggaaattatctgacagcctgaccttagaggatgccaaaagaata
cgagtgatgggagacatacccatggagcttgtcaatgaggtcatgctcaccataacagat
cctgcagccatgctgggccctgatacgagcttgctttcagccaacgcagcacgagatgag
actgctcgcttggaagaaagaagagggataatagagtttcatgtaatcggaaactctctg
tctcaaaagtcaaacaaaaagatccttatgtggcttgtgggtctgcaaaatgtgttctct
catcagcttccacggatgccaaaggagtacataacccggcttgtctttgacccaaaacac
aaaaccttggctctaattaaagatggccgtgtaattgggggcatctgtttccgaatgttc
cccactcaaggattcactgagattgtgttctgtgcagtgacttccaatgaacaagtaaag
ggttatggcactcacctaatgaaccatttgaaggaatatcatatcaagcacaacattctg
tacttcctgacgtacgcggatgaatatgccatcgggtattttaagaaacagggattttcc
aaggacatcaaagttccaaaaagtcgttacttggggtacatcaaggattacgagggagcc
actttaatggagtgtgaactgaaccccagaataccttatacagaactctcccacataatc
aaaaagcaaaaggagataataaagaagcttattgaacgcaggcacgctcagatccgcaaa
gtctatcctggccttacgtgttttaaagaaggcctccgacagatcccagtggagtgcatt
cccggaatacgagagaccggctggaaaccagcatgtaaagacaaagggaaagagattaaa
gacccagaccagctgtataacatcctgaagaaccttctagcacaaatcaaaactcaccca
agcgcttggccattcatggagcccgtgaaaaagtccgaggcaccggattactacgaagtg
atccgattcccaatagatttgaagaccatgacagagaggctgaaaaaccgctactacgta
accaagaagatattcatcgctgacctgcagaggatcattaccaactgccgagagtataac
cccccagacagcgattactgcaagtgtgccaacacgctggagaaattcttctacttcaag
ctcaaagaagccgggctgatcgacaaatga

DBGET integrated database retrieval system