KEGG   Xenopus tropicalis (western clawed frog): 100492735Help
Entry
100492735         CDS       T01011                                 

Gene name
kat2a, gcn5
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100492735 (kat2a)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100492735 (kat2a)
Transcription machinery [BR:xtr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100492735 (kat2a)
Chromosome [BR:xtr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100492735 (kat2a)
   HAT complexes
    PCAF complex
     100492735 (kat2a)
    STAGA complex
     100492735 (kat2a)
    TFTC complex
     100492735 (kat2a)
    SAGA complex
     100492735 (kat2a)
    SLIK complex
     100492735 (kat2a)
    ADA-HAT complex
     100492735 (kat2a)
    HAT-A2 complex
     100492735 (kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
10
AA seq 663 aa AA seqDB search
MVVDVENLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMIRPVVEGSLGSPPFEKPNIEQG
VLNFVQYKFSHLQPKERQTMYELSKMFLLCLNYWKLETPSQFRQRSQNEDVATYKVNYTR
WLCYCHVPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILT
HFPKFLSMLEEEIYGENSPIWEADFTVPTTEGAQLVSRPAAVNTTSVPSTPLFNNNLNNS
SSLSSSGDTSSSEPMPGEKRKLSDSLTLEDAKRIRVMGDIPMELVNEVMLTITDPAAMLG
PDTSLLSANAARDETARLEERRGIIEFHVIGNSLSQKSNKKILMWLVGLQNVFSHQLPRM
PKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHL
MNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECE
LNPRIPYTELSHIIKKQKEIIKKLIERRHAQIRKVYPGLTCFKEGLRQIPVECIPGIRET
GWKPACKDKGKEIKDPDQLYNILKNLLAQIKTHPSAWPFMEPVKKSEAPDYYEVIRFPID
LKTMTERLKNRYYVTKKIFIADLQRIITNCREYNPPDSDYCKCANTLEKFFYFKLKEAGL
IDK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggacgtagaaaatctcttcatgtccgttcacaaagaggaagacacagacacc
aagcaagtttacttttacttgtttaagctgctaaggaagtgtatccttcagatgatccgg
ccagtggtagagggatctttgggaagcccaccatttgaaaagccaaatatagaacagggc
gtcctgaattttgtccagtacaagttcagccatctgcagcctaaggaacgtcaaactatg
tatgagctgtccaaaatgttcctcctgtgcttaaattactggaagcttgaaactccttca
cagttccgtcagagatcacagaatgaggatgtagcgacatacaaggttaattataccagg
tggctctgttactgccacgtaccacagagctgtgacagcctgccacgctatgaaactaca
catgtgtttgggaggagtctgctccgttccatcttcactgttacccggagacaactgctg
gagaagttcagggtggagaaggacaagcttgttcccgagaagcggactcttatccttaca
cacttcccaaagttcctctccatgctggaagaagaaatctatggtgaaaactcacccatc
tgggaggcagattttactgttccaaccacagaaggtgcccaactagtgtctcgtccagct
gctgtcaacactacttcagtcccctctactcctctcttcaacaacaatctaaacaacagt
tcttctctctcgtccagtggggacactagcagttcagaaccaatgccaggtgagaaaagg
aaattatctgacagcctgaccttagaggatgccaaaagaatacgagtgatgggagacata
cccatggagcttgtcaatgaggtcatgctcaccataacagatcctgcagccatgctgggc
cctgatacgagcttgctttcagccaacgcagcacgagatgagactgctcgcttggaagaa
agaagagggataatagagtttcatgtaatcggaaactctctgtctcaaaagtcaaacaaa
aagatccttatgtggcttgtgggtctgcaaaatgtgttctctcatcagcttccacggatg
ccaaaggagtacataacccggcttgtctttgacccaaaacacaaaaccttggctctaatt
aaagatggccgtgtaattgggggcatctgtttccgaatgttccccactcaaggattcact
gagattgtgttctgtgcagtgacttccaatgaacaagtaaagggttatggcactcaccta
atgaaccatttgaaggaatatcatatcaagcacaacattctgtacttcctgacgtacgcg
gatgaatatgccatcgggtattttaagaaacagggattttccaaggacatcaaagttcca
aaaagtcgttacttggggtacatcaaggattacgagggagccactttaatggagtgtgaa
ctgaaccccagaataccttatacagaactctcccacataatcaaaaagcaaaaggagata
ataaagaagcttattgaacgcaggcacgctcagatccgcaaagtctatcctggccttacg
tgttttaaagaaggcctccgacagatcccagtggagtgcattcccggaatacgagagacc
ggctggaaaccagcatgtaaagacaaagggaaagagattaaagacccagaccagctgtat
aacatcctgaagaaccttctagcacaaatcaaaactcacccaagcgcttggccattcatg
gagcccgtgaaaaagtccgaggcaccggattactacgaagtgatccgattcccaatagat
ttgaagaccatgacagagaggctgaaaaaccgctactacgtaaccaagaagatattcatc
gctgacctgcagaggatcattaccaactgccgagagtataaccccccagacagcgattac
tgcaagtgtgccaacacgctggagaaattcttctacttcaagctcaaagaagccgggctg
atcgacaaatga

DBGET integrated database retrieval system