KEGG   Xenopus tropicalis (western clawed frog): 100492776Help
Entry
100492776         CDS       T01011                                 

Definition
alpha-1A adrenergic receptor-like
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100492776
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100492776
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100492776
   04270 Vascular smooth muscle contraction
    100492776
G protein-coupled receptors [BR:xtr04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100492776
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 489 aa AA seqDB search
MIKSWRDNIYARSSAISFTMVILYENNTVESIQLCLNCTHPGATINISKAIVVGVIFGVF
ITFGVLGNILVILSVACHRHLQTVTHYFIANLAVADLLLMSMVLPFSATFEIQGYWLFGR
IFCNIWAAVDVLCCTASIMSLCAISIDRYIGVSYPLRYPSIMTEKRGVLALLCIWVLSLV
ISIGPLFGWKQPAPEDDKICEITKEPGYALFSAFGSFYLPLSIILVMYFRVYIVAKRESK
VLTSGMKLEKSDSEEVTLRIHRKSTPESIGSTSSSKQKTQFSVRLLKFSREKKAAKTLGI
VVGCFVLCWLPFFLVMPIGSIYPPANSSDTIFKITFWLGYFNSCINPVIYPCSSPEFRKA
FQNILHARCSHRRQAASKYSSGFLLNSPVHRSSEENKNVVRIPVGSGEMFYRISKSDEGC
EWKYFTPLPSPATPYGTPRDFANCSSARVSSKSFLRTCCCVGTQQTRSCHDVPTIKIHTI
SVSENGEAV
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgattaagagctggagagacaacatctatgcaagatcttctgccatctccttcactatg
gtaattctctatgaaaataacacagtagaaagcatccagctctgcttgaactgcacccat
ccgggggcaacaatcaacatttccaaggccattgtggttggtgttatttttggggtgttc
atcacttttggagttcttggaaatatcttggttattctttcagtggcctgtcatcggcat
cttcagactgtgactcactattttattgccaaccttgccgttgctgacctgctcttaatg
tccatggtgcttccattttctgcaaccttcgagatacaaggttactggttgtttggtcgc
atcttttgcaacatctgggctgctgtggatgtcctctgttgtacagcctccataatgagt
ctgtgtgccatatccattgacagatacataggagttagctacccacttagataccccagc
atcatgactgaaaaaagaggtgttctagctttgctttgtatatgggttttgtcccttgtg
atctcgattggacctctatttggttggaagcagccagctccagaagatgataaaatctgt
gaaatcactaaagaaccagggtatgcacttttctcagcctttggatcattctacctgcct
ctcagtatcatccttgttatgtactttagggtatatattgtggccaaaagggaaagcaaa
gtgttaaccagtggaatgaagcttgagaagtctgattctgaggaggtaaccttaaggatt
catcggaaaagcaccccagaaagcatcggttccacttctagttcaaagcaaaagactcaa
ttctcagtgcgccttctcaagttttccagagaaaagaaagctgctaagactttgggtatt
gtagtaggatgcttcgtgctgtgctggcttccattttttcttgtcatgcctataggatcc
atttatcctccggccaactcgtcggatactattttcaagattacgttttggctgggttat
tttaacagctgcatcaacccagtgatctatccttgttccagccccgagttccggaaggcc
ttccaaaacatactccatgctcggtgctcgcacaggaggcaggctgccagcaagtactcc
tctggtttcctcctaaacagcccagtgcaccggagttcagaggaaaacaaaaatgtggtg
agaattcccgtgggctcgggggagatgttttacaggatctccaagtctgatgagggttgt
gaatggaaatattttacccccctgcccagcccggccacgccatacggcactccaagagat
tttgccaactgttcctctgccagagtgagcagtaagtcttttctgagaacctgctgttgt
gttggcacccaacagactcgctcttgccatgacgtgcccaccatcaagatacataccatc
tctgtgagcgagaacggtgaagccgtttga

DBGET integrated database retrieval system