KEGG   Xenopus tropicalis (western clawed frog): 100492798Help
Entry
100492798         CDS       T01011                                 

Definition
lysozyme C, milk isozyme-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100492798
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100492798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 153 aa AA seqDB search
MNSAVLFWGGIFIFTVTDGKVFERCELAGIMKKMGLDGYRGYSLPNWVCTAFFESSFYTD
RTNFNRGDNSTDYGILQINSRWWCNDNKTPGSHNACNINCRALLSDDITQSVICAKRVVR
DPQGMEAWVGWRNHCKGRDLSQWIKDCKLDILP
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgaactctgcagtgcttttctggggggggatttttatttttacagtcacagatggaaaa
gtattcgaaagatgtgaacttgctggaattatgaagaagatgggacttgatgggtatcga
ggatacagcctgcctaactgggtgtgtacagctttttttgagagctcattttatacagac
cgtacaaatttcaacagaggagataacagcactgattatggcattctccaaataaacagt
cgttggtggtgtaatgacaacaagactccaggaagtcacaatgcttgcaacattaattgc
agagctctcttgagtgatgacatcacccagtctgtgatatgtgcaaaacgcgttgtaaga
gacccacagggcatggaagcatgggttggctggagaaatcattgcaaaggaagagacctt
tctcagtggattaaagactgcaaacttgatattcttccgtag

DBGET integrated database retrieval system