KEGG   Xenopus tropicalis (western clawed frog): 100492973Help
Entry
100492973         CDS       T01011                                 

Definition
perforin-1-like
Orthology
K07818  
perforin 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 481 aa AA seqDB search
MSVNKEQLYLSNCSQSTDGWYYVGTQALEAALAIADWRPYSSCSRKITSDVSRSSVSLAE
DASSGVQNDWKAGLELQAPVGNVKAVLAGSHSQLAKFVESKTNRDRYSFLRHQLKCLYYS
LRLTPKPPLSNHFWKELQDLPKTYDTGTQQTFYRFIRVYGTHYISQAEVGGQVSEVTAIR
TCQATMDGLSLDELKDCLSLEASASVTGKMEANAEAKTCKEMSQKATRGESFHKTFNEKD
WQISGGKVTFDLLSFDVSKDGSTAAFGEWMESLKSHPDIVTYSLESVHNLVRFKGPQKEN
LRKAISDYIMEKALRKNCSCPGGTYPNQGAECSCVCSQSPDRNANCCPTRRGLAKLAVTI
NRASGLWGDYGSKTDAYVQVLFRSTKAVTPTTWNNNNPVWNERFDLGVVELSPGEELKIE
VWDEDNKYDDDRIGFCKRTLTSDLNKQICYCDHGRLDYTLHVACLPHLSGPYCQDYAPSK
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaacaaggaacaactatatctgagcaattgcagccaatctaccgacggttgg
tattacgttggtactcaagcacttgaagctgcccttgctattgccgattggaggccttac
agctcctgctctaggaagattaccagtgacgtctcccgttcttccgtctcattggccgag
gatgcctcatcaggagtgcaaaatgactggaaggcaggtttggagcttcaggctcccgtg
ggaaatgtaaaagcagtgctagccggatcccactcccagctggccaagtttgtggagagt
aaaactaatcgtgaccgttacagttttcttcgacatcagctcaaatgtctctactacagc
ttacgcctcacacccaagcctccattaagcaatcatttctggaaggagctacaagacctg
cccaagacttacgacaccggcacacagcaaacgttttataggttcattcgagtttatggc
actcattatatcagccaagctgaggtgggaggccaagtgtcagaggtcacagccatcaga
acctgccaagcgaccatggatggcctgtctttggatgaactgaaggactgtctcagcttg
gaggcctctgcttctgtcacgggcaaaatggaggccaacgctgaagccaaaacctgcaag
gaaatgagccagaaagccacccgtggtgagagcttccacaagaccttcaatgaaaaagac
tggcagatatctggtggcaaagtgacctttgatctcctctccttcgacgtcagtaaagat
ggcagtacggccgctttcggagaatggatggagagcctgaagtcccacccagatattgtc
acctactccctggagtccgttcacaacctagtgagattcaaagggccacaaaaggagaat
ctgaggaaagctatcagtgattacatcatggagaaggctctgaggaagaactgttcctgc
ccagggggcacttacccaaaccagggggcggagtgttcgtgtgtctgtagccaaagccct
gacagaaatgcaaattgctgcccaaccagaagagggcttgctaagctggcggtgaccatc
aatcgagcctcaggtctctggggggattatgggtctaaaaccgacgcgtatgtgcaagtc
ctgttccgttctacaaaggcggtgacacccaccacgtggaacaataataaccccgtctgg
aacgaacgctttgatctgggagtcgtggaactgagccccggggaagagctgaagatcgaa
gtttgggacgaagataataaatatgacgatgaccgcattgggttttgtaaacgtaccctg
accagcgacttaaacaaacaaatctgctactgtgaccatggccgcctagattatactctg
cacgtggcttgtcttcctcacctctccgggccctactgccaagattatgccccttctaaa
gaatag

DBGET integrated database retrieval system