KEGG   Xenopus tropicalis (western clawed frog): 100492973Help
Entry
100492973         CDS       T01011                                 

Definition
(RefSeq) perforin-1-like
  KO
K07818  
perforin 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Apoptosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100492973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 463 aa AA seqDB search
MQNRQFHYDSKAALAIADWRPYSSCSRKITSDVSRSSVSLAEDASSGVQNDWKAGLELQA
PVGNVKAVLAGSHSQLAKFVESKTNRDRYSFLRHQLKCLYYSLRLTPKPPLSNHFWKELQ
DLPKTYDTGTQQTFYRFIRVYGTHYISQAEVGGQVSEVTAIRTCQATMDGLSLDELKDCL
SLEASASVTGKMEANAEAKTCKEMSQKATRGESFHKTFNEKDWQISGGKVTFDLLSFDVS
KDGSTAAFGEWMESLKSHPDIVTYSLESVHNLVRFKGPQKENLRKAISDYIMEKALRKNC
SCPGGTYPNQGAECSCVCSQSPDRNANCCPTRRGLAKLAVTINRASGLWGDYGSKTDAYV
QVLFRSTKAVTPTTWNNNNPVWNERFDLGVVELSPGEELKIEVWDEDNKYDDDRIGFCKR
TLTSDLNKQICYCDHGRLDYTLHVACLPHLSGPYCQDYAPSKE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacaggcagtttcactatgactcaaaagctgcccttgctattgccgattggagg
ccttacagctcctgctctaggaagattaccagtgacgtctcccgttcttccgtctcattg
gccgaggatgcctcatcaggagtgcaaaatgactggaaggcaggtttggagcttcaggct
cccgtgggaaatgtaaaagcagtgctagccggatcccactcccagctggccaagtttgtg
gagagtaaaactaatcgtgaccgttacagttttcttcgacatcagctcaaatgtctctac
tacagcttacgcctcacacccaagcctccattaagcaatcatttctggaaggagctacaa
gacctgcccaagacttacgacaccggcacacagcaaacgttttataggttcattcgagtt
tatggcactcattatatcagccaagctgaggtgggaggccaagtgtcagaggtcacagcc
atcagaacctgccaagcgaccatggatggcctgtctttggatgaactgaaggactgtctc
agcttggaggcctctgcttctgtcacgggcaaaatggaggccaacgctgaagccaaaacc
tgcaaggaaatgagccagaaagccacccgtggtgagagcttccacaagaccttcaatgaa
aaagactggcagatatctggtggcaaagtgacctttgatctcctctccttcgacgtcagt
aaagatggcagtacggccgctttcggagaatggatggagagcctgaagtcccacccagat
attgtcacctactccctggagtccgttcacaacctagtgagattcaaagggccacaaaag
gagaatctgaggaaagctatcagtgattacatcatggagaaggctctgaggaagaactgt
tcctgcccagggggcacttacccaaaccagggggcggagtgttcgtgtgtctgtagccaa
agccctgacagaaatgcaaattgctgcccaaccagaagagggcttgctaagctggcggtg
accatcaatcgagcctcaggtctctggggggattatgggtctaaaaccgacgcgtatgtg
caagtcctgttccgttctacaaaggcggtgacacccaccacgtggaacaataataacccc
gtctggaacgaacgctttgatctgggagtcgtggaactgagccccggggaagagctgaag
atcgaagtttgggacgaagataataaatatgacgatgaccgcattgggttttgtaaacgt
accctgaccagcgacttaaacaaacaaatctgctactgtgaccatggccgcctagattat
actctgcacgtggcttgtcttcctcacctctccgggccctactgccaagattatgcccct
tctaaagaatag

DBGET integrated database retrieval system