KEGG   Xenopus tropicalis (western clawed frog): 100493483Help
Entry
100493483         CDS       T01011                                 

Gene name
hdac9
Definition
histone deacetylase 9
Orthology
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100493483 (hdac9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 596 aa AA seqDB search
MLQTIYESESYFSSDGVAGREQLLAEQRMHAMISKDIKSEFPIGLEPISPLDLRTDLRTA
MPVVDPVLREKQLQQELLIIKQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHLKLQQEL
LAMKHQQELLEREKEHKMEQQRKEQEAERHRREQQLCHPRSKDRVKERAVASTEVKQKLQ
EFILSKSATKESLTNGASHSMGRHPKLWYTAAHHTSLDQSSPPPSGTSPTYKCPLPGNQD
DFPLRKTASEPNLKVRSRLKQKVVERRSSPLLRRKDGNVTSSYKKRIFEVTESVSSSSPV
SGPSSPNNGPVAMEAENEVPVLSANSRIENLVSHHHLVHHEKSLNLLNLYTSPSLPNITI
GLHATATQLNTSSSLKEQQKYDPQAPRQGVSVAGQYAGGIPTSSNHVSLEGKTNSSHQAL
LQHLLLKEQMRQQKILASGGTPVLHQSPLPAKERVSPAGRVAHKLPRHRPLHRTQSAPLP
QSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKILSKSIEQLRQPEGHLEEAEEDLHGDNVI
QEKSSSADNTRSYSSTDLRTGHLGSVKVKEEPPDSEDEIKTHLQSEQKAVFVQQVT
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagacaatttatgagagtgaatcctatttttcctcagatggagtagctggacgg
gagcagctgctggcagagcagaggatgcacgccatgatcagcaaagatataaagtctgag
tttcccattggcctggagcccatctcccctttagacttaaggaccgatctcaggacagca
atgcctgttgtggatccagttctgagagagaaacagctgcagcaggagcttctaataatt
aaacagcaacagcaaatacagaagcaacttctaattgcagagtttcagaagcagcatgaa
aaccttacaaggcaacaccaggcccagctccaggagcacctcaagcttcagcaagagctt
ctagcaatgaagcatcaacaagagctcctggagagagagaaggagcataaaatggagcag
cagaggaaagaacaggaagcagaaaggcatcgtcgggagcagcagttatgtcaccctcga
agcaaagacagagttaaagaaagggcagtggccagtacagaagtgaaacagaagctccaa
gagttcatcttaagtaagtcggcaactaaagaatctttgacaaacggagccagtcattcc
atgggacgccaccccaagctttggtacacggcagcgcatcatacatcactggatcaaagt
tcacctccgcctagtggtacatccccaacatataaatgtcctctgccaggaaatcaggat
gacttccctttaaggaaaactgcatcagagcccaatttgaaagttcggtctcgtttgaaa
cagaaagtagtggagagacggagcagccccttactgagaaggaaggatggcaatgttacc
agctcatacaaaaaaagaatatttgaggtcacagagtcagtgagcagcagctctccagta
tctggacccagctccccaaataatggtccggttgccatggaagccgaaaatgaagtccct
gttttgtcagctaattcccgtatagagaatctggtttcacatcatcatcttgtgcatcat
gaaaagtctttaaaccttctaaacctatatacatccccttctttgcccaacattactata
ggactgcatgcaacagctactcagcttaatacctcatcttcattaaaagagcaacaaaag
tacgaccctcaggcaccccggcagggggtttctgtggccggacagtacgctggaggcatc
cctacatcctcaaatcacgtttccctggaaggaaagaccaatagcagtcaccaggcccta
ctgcaacacttactgttgaaagaacagatgcgtcagcagaagattttagcttcaggtggg
acacctgttctgcatcagtcgcccctaccagctaaggaaagagtttcaccagctggaaga
gtggctcacaaactgcctcgccacaggccccttcaccgaacccaatctgctcctttgccc
cagagcacactggctcaactggttatccaacagcagcaccagcagttcttggagaagcag
aaacaatatcaacaacagattcacatgaacaaaatactttccaaatctattgagcaactt
cgacaacctgaggggcatcttgaagaagccgaggaagatcttcatggagataatgtgata
caagaaaagagttcctctgcagacaacacaagaagttacagcagtacagatcttaggaca
ggacatctcggatctgtaaaagtgaaagaggagccaccagatagcgaggatgaaattaaa
acacaccttcagtctgaacagaaggcagtttttgtgcaacaggtaacctga

DBGET integrated database retrieval system