KEGG   Xenopus tropicalis (western clawed frog): 100493559Help
Entry
100493559         CDS       T01011                                 

Gene name
tmx3
Definition
thioredoxin-related transmembrane protein 3
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 454 aa AA seqDB search
MAATGFCFILATVASTSLLASLPVSALVEDLDDSFKENRKDDIWLVDFYAPWCGHCKKLE
PVWNEVGIEMRSSGSPIRVGKMDATVHSSIASEFGVRGFPTIKVLKGDMAYNYRGPRTKE
DIVEFANRVAGPLIRPLPSQQMFDHVQKRHSVLFVYVGVESTLKEKYIEVASELIVYTYF
FSSSEDVLPKYVTLNEVPAVLVFKDSTYFVYDEYEDGDLSSWVNKERFEGYLHIDGFTLY
ELGDTGKLVAVAVIDEKNNSVEHTRLKSIAQDVAKNYRDHFHRDFQFGHMDGNDYINSLL
MDELSIPTFVVLNTSNQQYFLPSKQIENTEEMIQFINSILDGTAEAQGGDGILQRIKRVF
YDAKSTVVSVFKSSPLLGCFLFGLPLGVISIMCYGICTADTEDGSEEMTRKDVIDQNGSD
EGSEEEQEEEKSREITDMSDEDQQEKDFMEKKID
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaccgggttctgctttatcttagcaacagtggcttctacttccctattggct
tctctccctgtttctgcattagtagaagatttggatgattcatttaaagaaaacagaaag
gatgatatctggcttgttgatttttatgcaccttggtgtggtcattgtaagaagcttgaa
cccgtctggaatgaagttggtattgagatgaggagtagcggctcacccattagagttggg
aaaatggatgctacagttcactcaagtattgcctcagaatttggggtcagaggatttcca
acaataaaggtgttgaaaggagatatggcttataactacagaggtccaagaacaaaagag
gatatagtagagtttgcaaacagagttgctgggccattaatccgtccacttccaagtcaa
cagatgtttgatcatgttcaaaaacgtcattcagtactttttgtatatgttggtgtagaa
tctacactaaaggaaaaatacattgaagttgcttcagaactcattgtgtacacatacttc
ttctcatcgtcagaggatgttttgcctaagtatgttacactaaatgaggtgccagcagtt
cttgtttttaaagactccacatattttgtttatgatgaatatgaagatggagatttatca
agttgggtgaataaggaaagatttgaaggatatcttcatatagatggatttacattgtat
gaacttggcgatacaggaaaattggtggctgttgcagttatagatgaaaagaacaattct
gttgaacatacaagactaaaatccattgctcaagatgtagcaaaaaactacagggatcat
ttccatcgagacttccagtttgggcacatggatggaaatgactacataaacagtttacta
atggatgaactcagcatccctacttttgttgttcttaacacatcaaatcagcaatatttt
ctgccaagcaaacaaattgaaaacactgaagaaatgattcagtttattaacagcattctg
gatggtacagcagaggctcaaggtggtgatgggatacttcagaggatcaagagggttttt
tatgatgccaaatctacagtggtttctgtcttcaagagttcacccctccttggctgcttt
ctctttggtctgccactgggtgtcatcagtataatgtgctatggaatctgtacagccgac
actgaagatggctccgaagaaatgaccagaaaggatgtcatagatcagaatggatctgac
gagggcagcgaggaagaacaagaggaagagaagagccgagagattacagatatgtcagat
gaagaccaacaagaaaaggattttatggaaaagaaaatagattaa

DBGET integrated database retrieval system