KEGG   Xenopus tropicalis (western clawed frog): 100493910Help
Entry
100493910         CDS       T01011                                 

Gene name
kcnmb3
Definition
potassium large conductance calcium-activated channel, subfamily M beta member 3
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    100493910 (kcnmb3)
Ion channels [BR:xtr04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   100493910 (kcnmb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 304 aa AA seqDB search
MTLFKEAMWMQPVAHRQSFSVPIQITLQGSRRRYMREAFTAVPAKVRRKESSSDGVKPAE
KMKKQASNAGEDRAMLLGFTMMGLSVLMFFLLGITILKPFMLSVWNEESNCTIIQADIME
DWVDCSFTCGVDCHGQSKYPCLQVLVNVSNSGQSAVLHYNEEAVQVNPKCFYIPRCQRDK
NDLLDGVMNIKEYFDRKNDTPFLCFHRPESKPEDVIFIKKYDRSVVFHCLFWPSLMLLGG
ALIVGMVKLTQHLSLLCKVYCSASKEELGSVASRPDSQQSKTKKEDKCLRWRLNSQSMSN
APFN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgactctgtttaaagaggcaatgtggatgcagccagtagcacacagacagtcgttcagt
gttcctatccagatcacactgcaaggcagccgcagacgctacatgagggaagccttcact
gcagtacctgccaaggtgagacgaaaagagagcagcagcgatggggtgaagccagctgaa
aaaatgaaaaaacaggcctccaatgctggggaagacagagcaatgctgctgggctttact
atgatgggactttcagtgctcatgttcttcttactgggtatcaccattctaaagccattc
atgctcagtgtctggaatgaagagtcgaactgcacaattatccaggctgatatcatggaa
gactgggttgactgttcgtttacatgtggcgtagattgccatggccaatcaaagtacccc
tgcctccaggtattggtgaatgtgtctaattctggccagtcagcagtcctgcattacaat
gaagaagcagtgcaagtaaacccaaagtgcttctatatcccaaggtgccaaagagataaa
aatgacttactggatggggtcatgaacataaaagaatattttgatcgcaagaacgacaca
ccttttttgtgtttccatcgcccagagagcaaaccggaggatgtcatcttcataaagaaa
tatgaccggtcggtggtcttccactgcctgttctggccttctctgatgctcctcggagga
gctctgatagtagggatggtgaagctaacgcagcacctctctctgttgtgcaaagtctac
tgcagtgcctctaaggaagagctgggcagcgttgcatcaaggcctgactcacagcagagc
aagaccaagaaggaagacaagtgtttaaggtggcgattaaactcccaaagcatgagcaat
gcaccatttaactga

DBGET integrated database retrieval system