KEGG   Xenopus tropicalis (western clawed frog): 100493933Help
Entry
100493933         CDS       T01011                                 

Gene name
adcy6
Definition
adenylate cyclase 6
Orthology
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Purine metabolism
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:xtr00230]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:xtr04114]
Cellular Processes; Cell communication; Gap junction [PATH:xtr04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:xtr04912]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:xtr04914]
Organismal Systems; Endocrine system; Melanogenesis [PATH:xtr04916]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:xtr04261]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:xtr04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1239 aa AA seqDB search
MQKGQAVRECAGGKRLDIYRCPIEISPNLPPNAIELVSSEAAALPHLSTRRNKCRVSPTQ
PGASGKLPTPSQESKMSWFSGILVPKVDERKTAWGERNGKKGKRKNTSLCGPRYMSCLQD
PEMDRNNRNNFGLRCTWQEDHYGKKGAGGDLGLKSVALGFEDGEVKGSKMGSTEVVGTED
GEQNLTPGECWVRFLQVFQSKKFQSAKLERLYQRYFFQMNQSSLTMLMGALVLVCLVMLI
FHCTHGEPQVVYVSVLAVAMALFLSLMVVCNRNGFHQDYMWIVSYLVIAVLFAVQVLGVL
MVTPRSASEGIWWSVFFIYIIYTLLPVRMRAAVLSGLILSSLHLIISWRLNLTDIFLWKQ
LSANVLIFLCTNIIGICTHYPAEVSQRQAFQETRGYIQARLHLQRENQQQERLLLSVLPR
HVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELF
ARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVN
VNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITSATLKYLNGDY
EVEPGNGGERNAYLKEHDIKTFLVTGCSQKRKEEKAMMARLQRARANSNEGLTRVWVPER
SFPRNKGSKAFRQMGIDESSKDNRNTQEALNPEDEVDEFLARAIDARSIDQLRKDHVKKF
LLTFQTPDLEKKYSKKVDDRFGGYVTCTLLVFCFICFIQIVIFPHSFLMLGVYTSVFIIL
ASILFVCAIYSCIKLFPAALQGVSRKIVQSRTNSTLIGILTILLVFTSAFVNMFACNHRS
LTDCAGQELNISYKFVNVCHLRMLNYSLSMDSPPCDSDKPLCNFPEYFNYSILLSLLACS
VFLQISSIGKLALMLFIQILYIVIVEGPEVVLFDNYDLLVTVNALPINGTGDIEECLPSS
KIALKFVTPVILTVFVLALYLHAQQVESTARLDFLWKLQATGEKEEMEQLQAYNRRLLHN
ILPKDVAAHFLAREHRNDELYYQSCECVAVMFASICNFSEFYVELEANNEGVECLRLLNE
IIADFDEIISEEKFKQLEKIKTIGSTYMAASGLNDTTYDKEGKTHITALADYAMKLREQM
KYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGLPDCIQVTT
DLYQVLAAKGYQMECRGVIKVKGKGEMTTYFLNDGPVSS
NT seq 3720 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagggccaagctgtgcgggaatgtgctggaggcaaacgattggatatctaccga
tgcccaattgagatctcacctaatcttcctcctaatgccattgaattagtaagctcagaa
gcagcagccctcccccacctctccacccgacggaataaatgccgtgtatcacccacccag
cctggagcctctgggaagctgccaactcccagccaggagagcaaaatgtcctggtttagt
ggtatcctggtccccaaagtggacgaacgaaagacagcatggggggagcgcaatgggaag
aagggcaagcgaaaaaacacctctttatgtggtcccagatatatgagctgccttcaggac
cctgaaatggacagaaacaaccgcaacaacttcggcctccgttgcacctggcaggaggac
cattatggcaagaaaggggcaggtggtgacctgggactcaaatccgtggcccttggattt
gaggatggggaggtgaagggctccaaaatgggatcaacagaagtggtgggcacagaggat
ggtgagcaaaatttgactcctggagagtgctgggtacgatttttacaagtgtttcagtcg
aagaaattccagtctgctaaactggagcgactataccaacggtacttcttccagatgaat
cagagtagtctgactatgttaatgggagcccttgtactggtttgcttggtcatgctgatc
tttcattgtactcatggggaaccccaggtagtctacgtatctgtccttgctgtagctatg
gctctgtttttgtcacttatggtggtgtgtaatcgcaacggctttcaccaggactacatg
tggatagtaagctaccttgtgatagcagtcctgtttgctgtgcaggttcttggggttctc
atggtgaccccacgtagtgcctctgaaggaatctggtggagtgtattctttatctatatt
atctataccctgctccctgtgcgcatgagggcagctgttctgagtggactaattctgtcc
tccctacacctaatcatctcctggaggctcaacctgacagacattttcctttggaagcag
ctcagcgccaacgtgctaatcttcctgtgtacgaacatcattggcatttgcactcattac
ccagcagaggtgtcccaaaggcaagcctttcaggaaacaagaggatacatccaggctagg
ctacacctacaaagagagaaccagcagcaggagcgtcttttgctttctgtcttaccacgc
catgtggccatggagatgaaggaagacatcaacaccaagaaggaggacatgatgttccac
aaaatctacattcagaaacatgacaatgtgagtatcctgtttgcagacattgaagggttt
accagtcttgcatcccagtgcacagcacaagaactggtcatgacacttaatgagctcttt
gcccgctttgacaagttggcagcagagaatcactgtctgagaataaagatcttaggagac
tgttactactgtgtctctgggttgcctgaagctcgtgcagatcatgctcactgctgtgtt
gagatgggagtggacatgattgaagccatttcgttggttcgagaggtgactggtgttaat
gtcaatatgcgtgtggggatacacagtggccgtgttcattgtggtgtccttggtctgcgc
aaatggcaatttgatgtctggtccaacgatgtgacactggccaatcatatggaggctggt
ggtaaagctgggcggatacacattacaagtgcaacgctgaaatacctaaacggagattat
gaagtggagccaggtaacgggggcgagaggaacgcgtacctaaaggaacatgacataaag
accttccttgtgacaggatgcagtcagaaaaggaaagaagagaaagcaatgatggcgagg
ctacagagggcaagggccaactccaatgaaggtctcacacgtgtctgggtgcctgagcga
tcgttcccacgcaataaaggctccaaggctttccgacaaatgggaattgatgaatcaagc
aaagacaacagaaacacgcaggaagcgctaaaccctgaggatgaagttgatgaattttta
gctagagcaatagatgctcgtagtatcgatcaacttcgaaaagaccatgtcaagaaattc
ctcctcacctttcagacgccagacttggagaaaaagtactccaagaaggttgatgaccgg
tttggtggctacgtgacctgcaccctgcttgttttctgctttatttgttttatccagata
gtgatctttcctcactcattcctcatgcttggagtctacaccagcgtctttatcatcctg
gccagtatactctttgtctgtgccatatattcgtgtataaagctctttccagcagcactg
caaggagtttctcggaagattgtgcaatcaagaaccaatagcactcttattgggatctta
accatactgttggtgtttacatcagcgtttgttaacatgtttgcctgtaatcacaggagc
ctcactgactgcgcaggtcaagaactgaacattagttacaagtttgtcaatgtctgccat
ctcagaatgctcaactacagcctgagtatggactctcctccatgtgactctgacaagccc
ttgtgcaatttccctgagtatttcaattacagcattctgctgagcctgttggcctgttct
gtcttcctgcagattagcagcattgggaaactggcacttatgcttttcattcagattttg
tacattgtcatcgttgagggaccggaggttgttctttttgacaactatgatctgctggtg
acagttaatgcactccccattaatggaactggggacatcgaagaatgcttgcccagcagt
aaaatagctctgaaatttgtgactcctgtcatattgactgtattcgttctggcactgtat
ctccatgcccagcaagtggagtccacggcgcgacttgacttcttgtggaagctgcaggcc
acaggagagaaggaagaaatggaacaactgcaagcctataaccgacgtctcctgcacaac
atcctcccaaaagatgtggccgctcactttctggcccgagaacacaggaatgacgagttg
tattaccagtcctgtgaatgtgtggcggtcatgtttgcctccatctgtaacttctctgag
ttttatgtggagctggaggcgaacaacgagggggttgaatgcctgcgactgctgaacgag
atcattgctgactttgatgagattatcagtgaagaaaaattcaagcagctagaaaagatt
aagactattggtagcacttacatggcagcatctggtctaaatgacaccacatatgacaaa
gagggaaagacgcatattaccgcccttgcagactatgccatgaagctcagggagcagatg
aagtacataaatgaacactccttcaataactttcagatgaaaatagggctgaatattggg
cctgtggtcgctggagttattggagctcgaaaacctcagtatgacatttggggaaacact
gtgaatgtagctagtcgcatggacagcactgggttaccagactgcatacaggttacaact
gatttgtaccaggtcctggcagccaaaggttaccaaatggagtgccgtggggttattaag
gtcaaagggaaaggagaaatgaccacctacttcctcaatgatggaccagtcagcagttag

DBGET integrated database retrieval system