KEGG   Xenopus tropicalis (western clawed frog): 100493933Help
Entry
100493933         CDS       T01011                                 

Gene name
adcy6
Definition
adenylate cyclase 6
Orthology
K08046  
adenylate cyclase 6 [EC:4.6.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Purine metabolism
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Gap junction
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100493933 (adcy6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100493933 (adcy6)
  Cellular commiunity
   04540 Gap junction
    100493933 (adcy6)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100493933 (adcy6)
   04914 Progesterone-mediated oocyte maturation
    100493933 (adcy6)
   04916 Melanogenesis
    100493933 (adcy6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100493933 (adcy6)
   04270 Vascular smooth muscle contraction
    100493933 (adcy6)
Enzymes [BR:xtr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100493933 (adcy6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1239 aa AA seqDB search
MQKGQAVRECAGGKRLDIYRCPIEISPNLPPNAIELVSSEAAALPHLSTRRNKCRVSPTQ
PGASGKLPTPSQESKMSWFSGILVPKVDERKTAWGERNGKKGKRKNTSLCGPRYMSCLQD
PEMDRNNRNNFGLRCTWQEDHYGKKGAGGDLGLKSVALGFEDGEVKGSKMGSTEVVGTED
GEQNLTPGECWVRFLQVFQSKKFQSAKLERLYQRYFFQMNQSSLTMLMGALVLVCLVMLI
FHCTHGEPQVVYVSVLAVAMALFLSLMVVCNRNGFHQDYMWIVSYLVIAVLFAVQVLGVL
MVTPRSASEGIWWSVFFIYIIYTLLPVRMRAAVLSGLILSSLHLIISWRLNLTDIFLWKQ
LSANVLIFLCTNIIGICTHYPAEVSQRQAFQETRGYIQARLHLQRENQQQERLLLSVLPR
HVAMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELF
ARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVN
VNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITSATLKYLNGDY
EVEPGNGGERNAYLKEHDIKTFLVTGCSQKRKEEKAMMARLQRARANSNEGLTRVWVPER
SFPRNKGSKAFRQMGIDESSKDNRNTQEALNPEDEVDEFLARAIDARSIDQLRKDHVKKF
LLTFQTPDLEKKYSKKVDDRFGGYVTCTLLVFCFICFIQIVIFPHSFLMLGVYTSVFIIL
ASILFVCAIYSCIKLFPAALQGVSRKIVQSRTNSTLIGILTILLVFTSAFVNMFACNHRS
LTDCAGQELNISYKFVNVCHLRMLNYSLSMDSPPCDSDKPLCNFPEYFNYSILLSLLACS
VFLQISSIGKLALMLFIQILYIVIVEGPEVVLFDNYDLLVTVNALPINGTGDIEECLPSS
KIALKFVTPVILTVFVLALYLHAQQVESTARLDFLWKLQATGEKEEMEQLQAYNRRLLHN
ILPKDVAAHFLAREHRNDELYYQSCECVAVMFASICNFSEFYVELEANNEGVECLRLLNE
IIADFDEIISEEKFKQLEKIKTIGSTYMAASGLNDTTYDKEGKTHITALADYAMKLREQM
KYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGLPDCIQVTT
DLYQVLAAKGYQMECRGVIKVKGKGEMTTYFLNDGPVSS
NT seq 3720 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagggccaagctgtgcgggaatgtgctggaggcaaacgattggatatctaccga
tgcccaattgagatctcacctaatcttcctcctaatgccattgaattagtaagctcagaa
gcagcagccctcccccacctctccacccgacggaataaatgccgtgtatcacccacccag
cctggagcctctgggaagctgccaactcccagccaggagagcaaaatgtcctggtttagt
ggtatcctggtccccaaagtggacgaacgaaagacagcatggggggagcgcaatgggaag
aagggcaagcgaaaaaacacctctttatgtggtcccagatatatgagctgccttcaggac
cctgaaatggacagaaacaaccgcaacaacttcggcctccgttgcacctggcaggaggac
cattatggcaagaaaggggcaggtggtgacctgggactcaaatccgtggcccttggattt
gaggatggggaggtgaagggctccaaaatgggatcaacagaagtggtgggcacagaggat
ggtgagcaaaatttgactcctggagagtgctgggtacgatttttacaagtgtttcagtcg
aagaaattccagtctgctaaactggagcgactataccaacggtacttcttccagatgaat
cagagtagtctgactatgttaatgggagcccttgtactggtttgcttggtcatgctgatc
tttcattgtactcatggggaaccccaggtagtctacgtatctgtccttgctgtagctatg
gctctgtttttgtcacttatggtggtgtgtaatcgcaacggctttcaccaggactacatg
tggatagtaagctaccttgtgatagcagtcctgtttgctgtgcaggttcttggggttctc
atggtgaccccacgtagtgcctctgaaggaatctggtggagtgtattctttatctatatt
atctataccctgctccctgtgcgcatgagggcagctgttctgagtggactaattctgtcc
tccctacacctaatcatctcctggaggctcaacctgacagacattttcctttggaagcag
ctcagcgccaacgtgctaatcttcctgtgtacgaacatcattggcatttgcactcattac
ccagcagaggtgtcccaaaggcaagcctttcaggaaacaagaggatacatccaggctagg
ctacacctacaaagagagaaccagcagcaggagcgtcttttgctttctgtcttaccacgc
catgtggccatggagatgaaggaagacatcaacaccaagaaggaggacatgatgttccac
aaaatctacattcagaaacatgacaatgtgagtatcctgtttgcagacattgaagggttt
accagtcttgcatcccagtgcacagcacaagaactggtcatgacacttaatgagctcttt
gcccgctttgacaagttggcagcagagaatcactgtctgagaataaagatcttaggagac
tgttactactgtgtctctgggttgcctgaagctcgtgcagatcatgctcactgctgtgtt
gagatgggagtggacatgattgaagccatttcgttggttcgagaggtgactggtgttaat
gtcaatatgcgtgtggggatacacagtggccgtgttcattgtggtgtccttggtctgcgc
aaatggcaatttgatgtctggtccaacgatgtgacactggccaatcatatggaggctggt
ggtaaagctgggcggatacacattacaagtgcaacgctgaaatacctaaacggagattat
gaagtggagccaggtaacgggggcgagaggaacgcgtacctaaaggaacatgacataaag
accttccttgtgacaggatgcagtcagaaaaggaaagaagagaaagcaatgatggcgagg
ctacagagggcaagggccaactccaatgaaggtctcacacgtgtctgggtgcctgagcga
tcgttcccacgcaataaaggctccaaggctttccgacaaatgggaattgatgaatcaagc
aaagacaacagaaacacgcaggaagcgctaaaccctgaggatgaagttgatgaattttta
gctagagcaatagatgctcgtagtatcgatcaacttcgaaaagaccatgtcaagaaattc
ctcctcacctttcagacgccagacttggagaaaaagtactccaagaaggttgatgaccgg
tttggtggctacgtgacctgcaccctgcttgttttctgctttatttgttttatccagata
gtgatctttcctcactcattcctcatgcttggagtctacaccagcgtctttatcatcctg
gccagtatactctttgtctgtgccatatattcgtgtataaagctctttccagcagcactg
caaggagtttctcggaagattgtgcaatcaagaaccaatagcactcttattgggatctta
accatactgttggtgtttacatcagcgtttgttaacatgtttgcctgtaatcacaggagc
ctcactgactgcgcaggtcaagaactgaacattagttacaagtttgtcaatgtctgccat
ctcagaatgctcaactacagcctgagtatggactctcctccatgtgactctgacaagccc
ttgtgcaatttccctgagtatttcaattacagcattctgctgagcctgttggcctgttct
gtcttcctgcagattagcagcattgggaaactggcacttatgcttttcattcagattttg
tacattgtcatcgttgagggaccggaggttgttctttttgacaactatgatctgctggtg
acagttaatgcactccccattaatggaactggggacatcgaagaatgcttgcccagcagt
aaaatagctctgaaatttgtgactcctgtcatattgactgtattcgttctggcactgtat
ctccatgcccagcaagtggagtccacggcgcgacttgacttcttgtggaagctgcaggcc
acaggagagaaggaagaaatggaacaactgcaagcctataaccgacgtctcctgcacaac
atcctcccaaaagatgtggccgctcactttctggcccgagaacacaggaatgacgagttg
tattaccagtcctgtgaatgtgtggcggtcatgtttgcctccatctgtaacttctctgag
ttttatgtggagctggaggcgaacaacgagggggttgaatgcctgcgactgctgaacgag
atcattgctgactttgatgagattatcagtgaagaaaaattcaagcagctagaaaagatt
aagactattggtagcacttacatggcagcatctggtctaaatgacaccacatatgacaaa
gagggaaagacgcatattaccgcccttgcagactatgccatgaagctcagggagcagatg
aagtacataaatgaacactccttcaataactttcagatgaaaatagggctgaatattggg
cctgtggtcgctggagttattggagctcgaaaacctcagtatgacatttggggaaacact
gtgaatgtagctagtcgcatggacagcactgggttaccagactgcatacaggttacaact
gatttgtaccaggtcctggcagccaaaggttaccaaatggagtgccgtggggttattaag
gtcaaagggaaaggagaaatgaccacctacttcctcaatgatggaccagtcagcagttag

DBGET integrated database retrieval system