KEGG   Xenopus tropicalis (western clawed frog): 100493994Help
Entry
100493994         CDS       T01011                                 

Definition
fatty acyl-CoA hydrolase precursor, medium chain-like
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100493994
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100493994
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     100493994
    3.1.1.84  cocaine esterase
     100493994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 569 aa AA seqDB search
MNSFPIRAECLQMGSLIKLLLLCCATLEIYGTEDARPLLTTKYGQLLGNTVGAKETDRLV
HVFMGVPFAKPPIGPLRFEAPQPPEPWSSVREATAAPPMCLQDKRGMEDLAEFFKAKFDF
PPVSEDCLYLNVFTPADRGENPELPVMVFIHGGALTMGGASMFEGSALCAYENVVVVSIQ
YRLGIMGFFSSGDKEVRGNFGFLDQVAALQWVRDNIKDFGGNPQSVTIFGESAGGVSVSA
QVLSPLSKGLFHKAIAESGVAILPGLMTSKTEEILPLLSVVANISSCSVSDLVGCLKKKT
EDEIIAITAAMRFLVFPAVVDGVFLPKPAEEILAAKESNPVPFLIGINNHEFGWILPLSL
NITGYREGMEKKNIQATLGALPLLNTVSSAIPFIMEEYFGDTDDPKELRNNFLDLVGDII
FVIPALRTAKYHRDSGFPVYFYEFQHRPSMYADSKDDFVKADHGDELYFVVGGPFLKSGI
LFKSNGTEEEKILSKTIMKYWANFARNGDPNGLGLAEWPKYDEDEDYLEINLTQKSSQRL
KGGRLKFWTITLPDKIKELMEEKGEHVEL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaattcattcccaatccgtgctgaatgtttgcaaatgggatccctgatcaaattgctt
ctcttgtgctgtgcgactctggaaatctatggaacagaggatgcaaggccactattaaca
acaaagtatgggcagcttcttggaaacacagttggcgcaaaggaaacagatagattagtt
catgtttttatgggagtcccctttgcaaagccacctatcggaccattaagatttgaggct
ccgcagccaccggagccatggagctctgtcagggaagccacagccgctccacccatgtgt
ttacaagataaaagaggaatggaagaccttgctgagtttttcaaggcaaagtttgatttt
cctccagtttctgaggattgtttgtacctaaatgtcttcactccagcagacagaggagag
aacccagagctccctgtcatggtgttcatacatggaggagcacttactatgggaggagca
tccatgtttgaaggctctgctttatgtgcctatgaaaatgttgttgtggtgtcaatccag
tatagacttggcattatgggattctttagttctggtgataaagaagtacgtgggaacttt
ggatttctggatcaggttgcagctttacaatgggttcgtgataatattaaggattttgga
ggaaacccacagtcagttacaatatttggggaatctgcaggtggcgtgagtgtatctgca
caggtgttgtccccactttctaaggggctgttccacaaagccattgctgagagtggagtt
gcaatacttcctggtttgatgaccagtaaaactgaagagatccttcctcttctatctgta
gttgctaacatatcctcctgtagtgtatcggacctggtaggctgtctcaaaaagaaaaca
gaagatgagattattgcgattactgcagcaatgagatttttagtgttccctgctgttgtc
gatggcgtgttccttcccaaacctgcggaggagatcttagctgccaaggagagcaatcca
gttccttttctgattggtattaataaccatgaatttggctggatactaccattgtctctt
aatatcactggatacagggaaggaatggaaaagaaaaacattcaggcaacacttggtgct
ctccctttgttgaatacagtttccagtgctattcctttcatcatggaagagtactttggt
gacacagatgatccaaaagagttaagaaacaatttcttggatctagttggggacattata
tttgttattcctgccctaagaacagctaaatatcacagagattcggggtttcctgtttac
ttctatgaatttcagcaccgcccttcaatgtatgcagactcaaaagatgattttgttaaa
gctgatcatggtgatgaactttactttgttgttggaggcccattcctgaaaagtggcatt
cttttcaaaagtaatggaacagaggaagagaaaatcctcagtaaaacaataatgaaatat
tgggctaacttcgctagaaatggggatcccaatggtcttggtttggctgagtggccaaaa
tatgatgaagatgaagactatctggaaattaacttgacacagaaatcatctcaaaggtta
aagggaggaagattgaaattttggaccatcacccttcctgacaaaattaaagagttgatg
gaagaaaaaggagaacatgtagagttataa

DBGET integrated database retrieval system