KEGG   Xenopus tropicalis (western clawed frog): 100494084Help
Entry
100494084         CDS       T01011                                 

Gene name
gbe1
Definition
glucan (1,4-alpha-), branching enzyme 1
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:xtr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 683 aa AA seqDB search
MATEVEEVEVPELKVLLGQDSYLKPYEKDFRRRYGLFCRLLKSIEGNEGGLEKFSRSYQS
FGIHLLENGGICCKEWAPGAEAVFLTGDFNGWNPFSHPYKKMDYGKWELHIPPREDKSVI
IPHGSKLKVVITSKSGETLYRISPWAKYVIREDNKAVYDWIHWEPPQPYKRKHASPKKLK
SVRIYESHVGIASSEGRIASYKNFTYNVLPKIKDLGYNCIQMMAIMEHAYYASFGYQVTS
FFAASSRFGTPDELKELIDVAHSMGIQVLLDVVHSHASKNSEDGLNKFDGTNACFFHDGA
RGNHDLWDSRLFDYSNWEVLRFLLSNLRWWLEEYGFDGFRFDGVTSMLYHHHGIGCGFSG
DYNEYFGLQVDEDSLVYLMLANHMTHTLYPDSITIAEDVSGMPALCCPISQGGTGFDYRL
AMAVPDKWIQILKELKDEEWDMGNIVHTLTNRRYNEKCIAYAESHDQALVGDKTLAFWLM
DAEMYTNMSVMSPLTPVIDRGIQLHKMLRLITHGLGGEGYLNFIGNEFGHPEWLDFPRKG
NGESYHYARRQFHLIDDNQLRYRFLYAFDRDMNKLEEKFGWLAAPQAYISAKHEDDKIIA
FERANLLFIFNFHPYKSFTGYRVGILKFMIALDTDASEYGGHERINHKTEFFTEHSPYNG
CSHSLLVYIPCRVALVLSNVDNS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggctacggaagtggaggaggtggaggtaccggagctgaaggtgctgttgggtcaggac
tcgtaccttaagccgtacgagaaagacttccgcagaaggtacggtttattttgccggctc
ttaaaaagcattgaaggaaatgaaggaggtttggaaaagttctccagaagttaccaatca
tttggcatccatttacttgaaaatggtggcatttgttgtaaagaatgggctcctggagca
gaagccgtgttccttactggcgattttaatggttggaaccctttttcacatccatataaa
aaaatggattatgggaaatgggaactacatattccaccccgtgaagataaatctgtgata
attcctcatggttcaaagctgaaggttgtaatcactagcaaatctggagagactctgtac
cgcatatctccttgggcaaaatatgtgattcgggaagataataaagccgtgtatgactgg
atacattgggaacctccacagccttataaacgcaaacacgctagccccaagaagctaaag
agtgtgcgcatatatgaatctcatgttggaattgcatcatcagaaggaagaattgcttca
tataaaaactttacatacaatgttctgcccaaaataaaagatcttggttataactgcatc
caaatgatggctattatggagcatgcatattatgcaagcttcggttatcaagtcaccagc
ttctttgcagcttcaagtcgctttggcacaccagatgagctgaaagaactgattgatgtt
gctcactcaatgggaatccaagttcttcttgatgttgtacacagccatgcatcgaaaaat
tctgaagatggcctcaataaatttgatggcacaaacgcctgcttttttcatgatggggct
cgaggaaaccatgatctttgggatagcagactttttgactactcaaactgggaagttttg
agattcctcctatcaaatttgcggtggtggcttgaggaatatggatttgatggttttcgg
tttgatggtgttacatccatgttgtatcaccaccatggaataggttgtggcttttctggt
gattataatgaatattttggactccaagtggatgaagactctctggtgtatcttatgttg
gcaaatcacatgacacatacactttatccagatagcattacaatagctgaggatgtgtcg
ggaatgccagcactttgctgccctatatctcaaggtggtactggatttgattatcgactg
gcaatggctgtgcctgacaaatggattcagatcttaaaagaactgaaggatgaagaatgg
gacatgggtaatatagtgcacaccctaaccaacagacgatataatgagaaatgtattgcc
tatgcagaaagccatgatcaggcacttgttggagataagactttagcattttggttaatg
gatgcagagatgtacacaaacatgagtgtaatgtcgcccttaactcctgttattgatcgt
ggaattcagctccataaaatgctacgcctgattactcatggtcttggaggtgaaggctat
ctcaatttcataggtaatgaatttgggcatccagaatggctagatttcccaaggaaagga
aatggggaaagctaccattatgccaggaggcagtttcatctaattgatgataatcagcta
cgctatagattcctctatgcttttgatagagatatgaataaactagaagaaaagtttgga
tggcttgctgcaccacaggcctatatcagtgcaaagcatgaggatgataagatcattgca
tttgaaagggcaaatcttcttttcatttttaatttccatccatacaaaagctttactggt
tacagagttggtattcttaagtttatgatcgctctggatactgatgcttcggaatatggt
gggcatgaaagaataaaccataaaacagaatttttcacagagcattcaccttacaatggt
tgttcacattcacttttggtctacattccatgcagggttgctcttgttctttccaacgtt
gacaactcctaa

DBGET integrated database retrieval system