KEGG   Xenopus tropicalis (western clawed frog): 100494278Help
Entry
100494278         CDS       T01011                                 

Definition
cGMP-dependent protein kinase 1-like
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Gap junction
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100494278
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100494278
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100494278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 685 aa AA seqDB search
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQRLQNELDKYRSVIKPATQQV
HKQNPTTLGEQRTKRQAISAEPTAIDIQELSHVTLPFYPKSPQSKELIKEAILDNDFMKN
LEISQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKESVKLCTMGPGKVF
GELAILYNCTRTATVKTLTNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLP
EEIVSKLADVLEETHYESGDYIIRQGARGDTFFIISKGKVNVTREDSPGEDPIFLRTLGK
GDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYE
AEAAFFGNLKLADFNIIDTLGVGGFGRVELVQLKSDECKTFAMKILKKRHIVDTRQQEHI
RSEKQIMQSAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFDDSTTRFYTA
CVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVA
PEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKITKN
AANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDT
SNFDSFPEDNEDPPPDDNSGWDIDF
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgggcactctgagggacttgcagtacgctctgcaggagaagatagaggagctcaggcag
agggatgcgctcatagacgaactggagctggagttggatcagaaggatgagctgatccag
aggctccagaacgaactggataagtaccgatctgtcatcaaaccggccacccaacaggtt
cacaaacagaaccccaccactttgggggagcagaggaccaagagacaggctatttctgca
gagccaactgccattgacatccaagagctgagccatgtcactcttcccttctaccccaag
agcccacagtccaaggaattaattaaagaagcgattctcgacaatgacttcatgaagaac
ctggaaatctcccagatccaagagattgtggattgtatgtaccccgtagaatatggcaag
gacagctgcatcatcaaggaaggggacgtgggctcgctggtgtatgtcatggaagatggc
aaggtggaagtgaccaaggaaagcgttaagttatgcaccatgggaccagggaaggtattc
ggggagctcgctatattgtacaactgcacccgcacagccaccgtcaaaacacttacaaat
gtgaaactctgggccatcgaccgacaatgtttccagacgataatgatgcggacggggctc
atcaagcacacggaatacatggagtttttaaaaagtgtcccaacattccagagccttcct
gaagaaattgttagcaagcttgctgatgtgcttgaagagactcactatgagagcggagac
tacataatcaggcaaggggctcgaggggacactttcttcatcatcagcaaagggaaggta
aatgtcacccgagaagattctcctggtgaggatccaatatttcttcgcactttagggaag
ggtgactggtttggtgagaaggctctgcagggggaagacgtcaggacagcgaatgtgatt
gccgccgaggccgtgacttgccttgttattgacagagactctttcaagcatctgattggg
ggcctggatgacgtttctaacaaggcgtatgaagatgccgaggcgaaagcaaaatatgag
gcggaggcggcgttcttcggcaacctcaagctggcagatttcaacatcatcgacacgctc
ggcgtcggaggcttcggaagggttgagctggtccagttgaaaagtgatgagtgcaaaaca
tttgcaatgaagatcctgaagaagagacacatagtggacacaaggcagcaagagcacatt
cggtcagaaaaacagatcatgcaaagcgcacactcagactttattgttaggttatacagg
acatttaaagacagcaagtatttatatatgttgatggaagcttgccttggtggagaacta
tggacgattctcagggacagaggttcattcgatgattcaacaacaaggttttacacggcg
tgtgtagtggaagcgtttgcttatctgcattccaaagggattatctacagagacctcaag
ccagaaaatctcatcctggaccatcgaggctacgcaaagctggttgattttggctttgca
aagaaaataggatttggtaagaaaacatggactttttgtggaaccccagagtatgtagcg
ccggagatcatcctgaacaaaggtcacgacatttcagccgactactggtcactgggaatc
ttaatgtatgagcttctgactggcagcccgcctttctcaggtccagatcctatgaagacg
tacaatatcatattgagaggcatcgacatgattgaatttccaaagaagattaccaaaaat
gctgctaatttaataaaaaaactatgcagggacaatccatcagaaaggttaggaaacttg
aaaaatggagtgaaagatattcaaaagcacaaatggtttgaaggctttaactgggaaggt
ttaaggaaaggcacattgacacctcctattataccaagtgttgcatccccaacagacaca
agcaatttcgacagctttcccgaggacaatgaagatccacctcctgatgacaattcggga
tgggacatagacttctag

DBGET integrated database retrieval system