KEGG   Xenopus tropicalis (western clawed frog): 100494406Help
Entry
100494406         CDS       T01011                                 

Gene name
prkx, pkx1
Definition
(RefSeq) protein kinase, X-linked
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100494406 (prkx)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   100494406 (prkx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 369 aa AA seqDB search
MEAAAAAVTVKARSGSRSAGKGSCDGGVASPSSGCLGLSGCGHTSSPCPELQQQYKLDDF
DTVATVGTGTFGRVHLVKEKMGKQYFALKVMSIPDVIRLKQEQHVHNEKSVLKEVNHPFL
VKLFWTSHDDRFLYMLMEYVPGGELFSYLRNMGRFNNSTGLFYSTEIICAIEYLHSKEIV
YRDLKPENILLDKEGHIKLTDFGFAKKLSDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWA
LGILIFEMLSGFPPFFDDNPFGIYQKILAGKIDFPRHLDLYVKDLIKKLLVVDRTRRLGN
MKNGADDVKRHRWFRSIDWDTVPPRKLKPPIIPKVTHEGDTSNFEAYPEDDWNKAPPVPP
KDLEMFNSF
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagcagctgctgctgtgacagtaaaagccaggtctggctctagaagtgctggc
aaggggagctgcgatggaggagttgctagccccagctcaggttgccttggactttctgga
tgtgggcacacttcatcgccatgcccagagctacagcagcagtacaaattggacgacttc
gatactgtagccacagtcggaactggcacatttggaagagtacacctggtaaaagagaaa
atgggcaagcaatattttgcattaaaagtaatgagcattccggatgtgattcgtctgaaa
caagaacaacatgtacataatgaaaaatctgtcttgaaagaggttaatcatccgtttcta
gtcaaactgttttggacctcacatgatgaccgcttcttatacatgctgatggagtatgta
cctggtggagagctttttagttacttacggaacatgggacgctttaataacagcactgga
ctgttttactcaactgaaattatttgtgcaatagaatatttgcactccaaagaaattgtt
tacagagatttaaaaccggaaaatattttgttagacaaagaagggcacatcaagcttaca
gactttggatttgcaaagaagctctcagacaggacatggacactttgcgggactcctgag
tatctggcaccagaagttattcagagcaaaggccatggaagagcagtggattggtgggct
ttggggattctaatttttgaaatgctttcagggtttcctcctttctttgatgacaatccc
tttggtatctatcagaagattttggctggaaagatagactttccaagacatttagactta
tatgtcaaagacctcataaagaaactccttgttgttgaccgaactagaaggcttggcaac
atgaagaatggggcagatgatgtcaaaaggcatcggtggtttagatcaatagactgggat
actgtaccgccaagaaaattaaaacctccaataataccaaaagtaacccatgaaggtgat
acatccaactttgaagcctatcctgaagatgactggaacaaagcaccgcctgtacctcca
aaagacttggaaatgtttaatagtttctaa

DBGET integrated database retrieval system