KEGG   Xenopus tropicalis (western clawed frog): 100494415Help
Entry
100494415         CDS       T01011                                 

Gene name
traf2
Definition
TNF receptor-associated factor 2
Orthology
K03173  
TNF receptor-associated factor 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:xtr04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:xtr04010]
Cellular Processes; Cell growth and death; Apoptosis [PATH:xtr04210]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:xtr04622]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:xtr04920]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:xtr05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 475 aa AA seqDB search
MAAAAAVSGSPQGSLDLNQPGFKKEILGTKLEVKYLCSDCKNLLRRPLQAQCGHRYCSHC
LNKIIRPSLLCSQVGHEGKCPYLLAPCPACKTIIRAANRDLHSERECPERKLNCRYCKLS
FYFPDIKAHDEICPKFPMTCEGCGRKKIPREKFPDHVKICGRCKVPCRYAAVGCTEMVEN
DKCLEHENKSLAEHLAKVWDYIQHGRKEQNDLSVRMGSLSVQGSPAPPANAPPNNSAKVA
EMLLKFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAAQEKVEALTTKVRQLER
TLGQKELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKY
GYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVIDA
FRPDVSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVDLTGL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagcagccgcagtgtccggctctccgcagggatctctggacctgaaccaaccg
gggtttaagaaggagattctgggcaccaagctcgaggtgaagtacctgtgttccgactgc
aagaatttattacggagacccctccaggcccagtgtgggcaccgctactgctcccattgc
ctcaacaagatcatcagaccgtctcttctctgttcccaggttggccacgaggggaagtgc
ccgtacttgttggcgccgtgcccggcctgtaagactataatccgcgccgccaatagggac
ttgcacagcgagcgagagtgcccggagcgcaagctgaactgccgatactgcaagttgtcc
ttttacttccctgacattaaggcgcacgatgagatctgccccaagttccccatgacgtgc
gaaggctgcgggcgcaagaagatcccgcgggagaagttcccagaccacgttaaaatctgt
gggaggtgcaaagtgccgtgtcgatatgcagcagtcgggtgcaccgagatggtggagaac
gacaaatgtctggagcacgaaaacaaatcattggccgagcacttggccaaagtgtgggac
tacattcagcacggccgaaaggagcagaacgacctgtcagtccgtatggggtcactgtcc
gtgcagggcagccccgcccctccggccaacgctccgcccaacaactccgccaaggtcgcc
gaaatgctgctcaagttcgacaccctggacaagaaaaacacaacgttcgagaacatcgtg
agcgtcctgaaccgggaggtggagcggtcgtcgcacgcggccgaggagctcgccaggcag
ctacgggcggcgcaggagaaagtggaagctttgactaccaaggtccgacagctggagcgc
actctggggcagaaggaactgatcgtggcggaactggagacgcggatgcaggagtcggaa
ttatccacctacgatggggtgtttatttggaaaatctctgagttcggcaagaagagacag
gacgccatcaacgggcgatgccccgccatgttctccccacctttttacactaacaaatac
ggctacaaaatgtgcctgcgcatctacctgaacggggacggcaccgggcgcaacacccac
ctgtcgctcttcttcgtggtgatgaagggaaacaatgatgctttgctgcgctggcccttt
aaccagaaggtcaccctgatgctgctcgaccagaacaaccgcgagcatgtgatcgacgcc
ttccggcccgacgtctcgtcgtcctccttccagcgcccaatcagcgagatgaacatcgcc
agcgggtgcccgctcttctgccaggtctccaagctggagggcaagaactcgtacgtccgc
gacgacaccatcttcgtaaaggttatagtggatctgactgggctctag

DBGET integrated database retrieval system