KEGG   Xenopus tropicalis (western clawed frog): 100494415Help
Entry
100494415         CDS       T01011                                 

Gene name
traf2
Definition
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  
TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100494415 (traf2)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100494415 (traf2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100494415 (traf2)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    100494415 (traf2)
  Endocrine system
   04920 Adipocytokine signaling pathway
    100494415 (traf2)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    100494415 (traf2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100494415 (traf2)
Messenger RNA biogenesis [BR:xtr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100494415 (traf2)
Ubiquitin system [BR:xtr04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    100494415 (traf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 471 aa AA seqDB search
MAAAAAVSGSPQGSLDLNQPGFKKEILGTKLEVKYLCSDCKNLLRRPLQAQCGHRYCSHC
LNKIISCSQVGHEGKCPYLLAPCPACKTIIRAANRDLHSERECPERKLNCRYCKLSFYFP
DIKAHDEICPKFPMTCEGCGRKKIPREKFPDHVKICGRCKVPCRYAAVGCTEMVENDKCL
EHENKSLAEHLAKVWDYIQHGRKEQNDLSVRMGSLSVQGSPAPPANAPPNNSAKVAEMLL
KFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAAQEKVEALTTKVRQLERTLGQ
KELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKM
CLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPD
VSSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVDLTGL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagcagccgcagtgtccggctctccgcagggatctctggacctgaaccaaccg
gggtttaagaaggagattctgggcaccaagctcgaggtgaagtacctgtgttccgactgc
aagaatttattacggagacccctccaggcccagtgtgggcaccgctactgctcccattgc
ctcaacaagatcatcagctgttcccaggttggccacgaggggaagtgcccgtacttgttg
gcgccgtgcccggcctgtaagactataatccgcgccgccaatagggacttgcacagcgag
cgagagtgcccggagcgcaagctgaactgccgatactgcaagttgtccttttacttccct
gacattaaggcgcacgatgagatctgccccaagttccccatgacgtgcgaaggctgcggg
cgcaagaagatcccgcgggagaagttcccagaccacgttaaaatctgtgggaggtgcaaa
gtgccgtgtcgatatgcagcagtcgggtgcaccgagatggtggagaacgacaaatgtctg
gagcacgaaaacaaatcattggccgagcacttggccaaagtgtgggactacattcagcac
ggccgaaaggagcagaacgacctgtcagtccgtatggggtcactgtccgtgcagggcagc
cccgcccctccggccaacgctccgcccaacaactccgccaaggtcgccgaaatgctgctc
aagttcgacaccctggacaagaaaaacacaacgttcgagaacatcgtgagcgtcctgaac
cgggaggtggagcggtcgtcgcacgcggccgaggagctcgccaggcagctacgggcggcg
caggagaaagtggaagctttgactaccaaggtccgacagctggagcgcactctggggcag
aaggaactgatcgtggcggaactggagacgcggatgcaggagtcggaattatccacctac
gatggggtgtttatttggaaaatctctgagttcggcaagaagagacaggacgccatcaac
gggcgatgccccgccatgttctccccacctttttacactaacaaatacggctacaaaatg
tgcctgcgcatctacctgaacggggacggcaccgggcgcaacacccacctgtcgctcttc
ttcgtggtgatgaagggaaacaatgatgctttgctgcgctggccctttaaccagaaggtc
accctgatgctgctcgaccagaacaaccgcgagcatgtgatcgacgccttccggcccgac
gtctcgtcgtcctccttccagcgcccaatcagcgagatgaacatcgccagcgggtgcccg
ctcttctgccaggtctccaagctggagggcaagaactcgtacgtccgcgacgacaccatc
ttcgtaaaggttatagtggatctgactgggctctag

DBGET integrated database retrieval system