KEGG   Xenopus tropicalis (western clawed frog): 100494517Help
Entry
100494517         CDS       T01011                                 

Definition
ubiquitin carboxyl-terminal hydrolase 12-B-like
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100494517
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100494517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 370 aa AA seqDB search
MEILMTVSRIASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFC
RPFREKVLAYKSQPRKKENLLTCLADLFHSIATQKKKVGVIPPKKFITRLRKENELFDNY
MQQDAHEFLNYLLNTIADILQEERKQEKQNGRIPNGNIDNENNNSTPDPTWVHEIFQGTL
TNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEECRSKQ
EAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMY
DLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSES
GYILFYQSRD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcctaatgacagtctccaggatcgcttctatctgtaccatgggcgccaatgcc
tcggctttagagaaagagattgggccggaacaatttccagtaaatgaacactattttggt
ttagtaaattttgggaacacctgctactgcaactctgttcttcaagcactttatttttgt
cggccgtttcgggagaaagttcttgcttacaaaagccaacccagaaagaaagagaatctt
ctcacttgcctggcagatctgttccacagtatagccactcagaagaaaaaggttggcgta
atccctccgaagaaatttatcaccaggctacggaaagaaaatgagctgtttgacaactac
atgcaacaggacgctcatgaatttctgaactatctgctaaacacaatagccgatattttg
caagaggagcgaaagcaagagaaacagaatggaaggatacccaatggtaacattgacaat
gagaacaacaatagcacacctgatcccacgtgggtccatgagatctttcagggaactctg
acgaacgaaactcgatgtcttacatgtgaaacgataagcagcaaagatgaggatttttta
gatctttctgtggatgtggagcagaacacatcaatcactcattgtttaaggggttttagt
aacacggaaacactttgtagtgaatataaatattactgtgaagagtgtcgcagtaagcag
gaagcacacaaaaggatgaaagtaaaaaagctgcctatgattttagccctccacctaaag
aggttcaagtacatggatcaactgcatcgatatacaaagctctcctacagagtcgtcttt
cctttagagctgcggctgtttaacacatcaggagatgccaccaacccagacagaatgtat
gaccttgtagctgtggttgtgcattgtggaagtggtccaaatagaggacattatattgca
atagtgaagagtcacgacttttggctgctgttcgatgatgatattgtagagaaaatagat
gcacaagctatagaggaattctacgggttgacatctgatatctctaagaactctgaatcg
ggatacattctcttctaccagtctcgagactga

DBGET integrated database retrieval system