KEGG   Xenopus tropicalis (western clawed frog): 100494605Help
Entry
100494605         CDS       T01011                                 

Gene name
unc13c
Definition
unc-13 homolog C (C. elegans)
Orthology
K15293  
protein unc-13
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2217 aa AA seqDB search
MVSTLLKSLVFSYIYKLCKGMFTKKLGNPTKKKESSSKKEQDISQFGLTKNPNISSTIKS
TVKKIAKCSSSCNLSTEEETIKKEFSLSPTFSYRVAIANGLQNNIVVSGSNEDGLQEISS
LDSSYSESLSETRASSNIKEYSSHTMPVRRNRKSLNSLAPSDGSSDGERTLHSLKMGALR
KLRKWKKSQECVSSDSEVSTWKKSWGLRSKSLDRTVRQQKTNTLEPSFSSTGCISQTHDV
MEMIFKELQGISQIETELSELRGHVNSLKQSIDEISSSVEVVQSEIEQLRTGFVQSRRET
RDIHDYIKQIGQQGNTAGLRFLNVPEEKQENCESVVFKILIEKMGFVDAQSSMKIELAHR
IGQQRECPNAKPRPILVYFGNPQHRDLVLKKCYKLKGTGIGVSTDILTQDLKIRKERLLP
SSQTYESMDMKFSALEPKINRNEWESHEDSDKELESDINRNSYAMISKSEAHIKNSSTKR
SSQTSHNKRSHKTSADATYTAKQEDGDLNFQSPVSDNLEKQGRGYYNDMAPLWHSQNDFL
TPKLSRSESDFSKLCQSYSEDFSENQYFVRTNGSSLLSSSDRELWQRRQEDGSSNWYASS
QEQAFSNEADPYPEENELENTETVDSGVSNGVICVSGDRSHYSDSQLSLHGDLSPWKEWH
QLEQGTDSGLDTSTQHVFAYNVNCPSNQQIEGYANTYEKCQSTDHQYSPENYDYSMDGNS
PSCPGNDSEAQNEWPSEFDAYTETNANDMYQNQTRLPMMYRSQSELQSDDSEDAPPKSWH
SRLSIDLSDKTFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYDESGSSFMGRFRTLSQST
ANESSTTLDSDVYAEPYYYKADDYDVEYNQSADDNENGADYVEVMEQVLAKLENRTNTNE
NLEQVQEYQAYEYNSYDTEFEPLQMDNYETQFVDTFDEEVVVPECEIAYDVTEKDDENQN
VPAEKVVEVPKKKRIRPSFKEAAMKAYKKEMADLEERILAGDSKAMDEKARIIGNSLDAS
KLYEIQTYGGPASGLYGIDSMPDLRRKKTIPIVRDVAMTLAARKAGISVAMGIRTFVNNE
ELKMHVFKKTLQALIYPISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMRCTECGVK
CHEKCQDLLNADCLQRAAEKSSKHGAEDKTQNIITAMKERMKIRERNRPEVFQLIQEMFQ
ISKEDFVQHTKASKQNVLDGTSKWSAKINITVVCAQGLQAKDKTGSSDPYVTVQVGKTKR
RTKTIFGNLNPVWDEKFHFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTFV
DVRTLSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEENVPPYHVQYTCLHENLFNHL
TEIQNNGIVKIPEVKGDEAWKVYFDDAAQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMC
PGVPAVMSTLLANINAFYAHTTATTNVSASDRFAATNFGRERFIKLLDQLHNSLRIDLSK
YRDNFPATNPERLQDLKSTVDLLTSITFFRMKVLELQSPPRASAVVKDCVRACLDSTYKY
VFVNCHDLYSQLLDQGKKQDVPREDQGPTIKNLDFWPNLITLMVTIIDEDKTSYTPVLNQ
FPQELNMGKLSAEVMWHLFAQDMKYAMEEHEKHRLCKSTDYMNLHFKVKWFYNEYVKELS
AFKDTVPEYSLWFETFVIQWLDENEDVSMEFLHGALGRDKKDGFQATSEHVLFSCSVVDV
FTQLNQSFEIIKKLECPNPEALSHFMKRFANTINKVLLQYAVIVSNDFSSYCGKENVPCI
LLNNIQQLRVQLEKMFENMGGKELDLDASAMLKELQVKLSGVLDELSCIYGASFQVVIED
CVKQMSVELNQMKGNGNASTNRNNAAMDAEIVLRPLMDFLDKTLSVSAKICEKTVLKRVL
KELWKLVLNRIEKQIVLPPLTDQTGAQMIFSAAKDLGQLSKLKDHVIREEAKSLSLRQCS
IMEVVLATIKQYFHAGGNGLKKNFLEKSPDLQSLKYALSLYTQTTDALIKKYIDTQTCQG
QSTEGSVGEISVQVDLFTHPGNGEHKVTVKIVALNGLLWQTTAMFRPFVEVFALGPSLSD
KKRKFGTKTKSNTWSPKYNENFQFILSNEESPRAYELHLCVKDYCFAREDRVIGMTVIQL
KNIVDKGNCASWYPLMKNICMDETGLTILRILSQRSNDEVAKEFVKLKSDIRSPEEI
NT seq 6654 nt NT seq  +upstreamnt  +downstreamnt
atggtttctaccctattgaagagcctggtcttctcttatatatataagctttgcaaagga
atgtttacaaagaaattgggaaatcctacaaaaaagaaagaaagctcaagcaaaaaggaa
caggatatttcccaatttggcctaacaaagaacccaaacatttcatctaccattaaaagc
acagtaaaaaagattgccaagtgttcttcttcctgtaacttatcaactgaagaagagaca
ataaagaaagaattttccctctctccaactttcagttacagggtagctattgccaatggt
ctacagaataatattgtggtaagtggtagtaatgaggatggtcttcaggaaatttcctct
cttgatagttcatattcagaatccctaagtgaaacaagggctagtagtaacattaaggaa
tattcatcccacacaatgccagtaaggcgcaataggaagagcttgaatagtctagctcca
tctgatgggagctcagatggggaacgtacactgcatagtctaaaaatgggtgctttacgt
aaattacggaaatggaagaaaagtcaagagtgtgtctcttcagattcagaggtgagcaca
tggaaaaagtcatggggcttgcgaagcaaatccttagacagaactgttcgtcagcagaaa
accaatacacttgaacccagctttagctccactggttgcattagtcagacacatgatgtt
atggaaatgatctttaaagaacttcaaggaataagtcaaatagaaactgagctttcagaa
ctaaggggacatgtaaattctcttaaacaatcaattgatgaaatttctagcagtgtggag
gttgtacaaagtgaaattgaacagttacgaactggatttgtacaatcaagaagagaaaca
agagatattcatgattacattaaacaaataggtcaacaaggcaacacggccggtcttaga
tttttaaatgtgcctgaagaaaagcaagaaaattgtgaaagtgttgtttttaaaatttta
atagagaaaatgggatttgtagatgcacaaagcagcatgaaaattgaacttgctcataga
ataggacaacaaagagaatgccccaatgcaaaacctagaccaattcttgtatattttgga
aatccacaacacagagatttggtgttaaaaaaatgttataaactaaaagggactggaatt
ggggtttcaacagatattcttactcaagatttgaaaattagaaaagagagacttttacca
tcttctcagacatatgagagtatggatatgaaattttcagcattggagccaaagattaat
cgtaatgaatgggaatcccatgaagatagtgacaaggaattagaatctgatattaacagg
aatagttatgcaatgatttctaaatccgaggctcatataaaaaatagcagcaccaaaaga
agcagccagacatcgcataacaaaagatctcataagacatctgctgatgccacatacaca
gctaaacaagaggatggggatcttaatttccagtcaccagtatctgataacttagaaaag
caaggcagaggatattataatgatatggctcctctgtggcattcacaaaatgactttttg
acaccaaaactaagtcgttcagaatctgatttttcaaagctgtgtcaatcatactctgaa
gatttttctgagaatcagtattttgtaaggaccaatggtagttctctcttatcttcttct
gatcgagagctgtggcaaagaagacaggaagatggctcatcaaactggtatgctagttct
caggaacaggcattcagtaatgaggcagatccctatccagaagaaaatgaactggagaat
actgaaactgttgatagcggtgtaagcaatggggtcatttgtgtttcaggtgatcggagt
cactatagtgattcacaactttctttacatggtgacttgtcaccttggaaagaatggcac
caattagagcaaggcacagattctggccttgatacttctacacagcatgtttttgcttac
aatgtcaattgcccctccaatcaacagatagaaggttatgcaaatacttatgaaaagtgc
caaagcacagatcaccaatatagtccagaaaactatgattactcaatggatggcaattct
ccatcttgtcctggcaatgacagtgaagcacaaaatgagtggcctagtgaatttgatgct
tatactgaaacaaatgccaatgatatgtatcagaatcaaacaagattgcccatgatgtac
agaagccagagtgaattgcaaagtgatgattctgaggatgctccaccaaagtcatggcac
agccgtctaagcatagacctttctgataaaacctttagctttcctaaatttggatcaact
cttcaacgtgccaagtcagccttggaagtagtgtggaataaaagcactcaaagtttaagt
ggttatgatgaaagtggctcttcatttatgggccgatttcggacactatcacagtcaaca
gctaatgagtctagcacaactcttgattcggatgtgtatgcagagccctattattataaa
gctgatgattatgatgtagaatacaaccaatcagcagatgataatgaaaatggggctgat
tatgttgaagttatggaacaggttctggccaagctagaaaacaggacaaatacaaatgaa
aatttagaacaagttcaagagtaccaagcatatgaatacaattcttatgatacagaattt
gagcctttacaaatggataattatgaaactcaatttgttgacacatttgatgaagaagtc
gtagtgcctgaatgtgaaatagcttatgacgtaactgaaaaggatgatgaaaaccaaaat
gtgccagcagaaaaagttgttgaagttccgaagaaaaaaagaatccgtcctagcttcaag
gaggccgcaatgaaagcatataaaaaggaaatggctgatctagaagagaggattcttgct
ggagatagcaaagctatggatgaaaaggcaagaatcattggaaactccttggatgcctcc
aaactctatgaaatccagacgtatggagggccagcaagtgggctttatggaattgacagc
atgcctgacctacgcaggaagaaaacaattcccattgtcagggatgtggccatgacactg
gctgcaaggaaagctgggatatcagtagcaatgggtatccggacatttgtaaacaatgag
gagttgaaaatgcatgtgttcaaaaaaacactacaagcgctgatctatccaatatcctcg
accacacctcacaactttgaggtttggactgcaacaacgccaacctactgctatgaatgt
gaaggcctgctttggggcattgcaaggcagggtatgagatgcacagagtgtggagtcaaa
tgccatgagaaatgtcaagaccttctgaatgctgactgcttacaaagagctgcagagaaa
agttccaagcatggcgcagaggacaaaactcagaacataatcactgcaatgaaggagaga
atgaaaatcagggagagaaaccgaccagaggtttttcagcttattcaagaaatgtttcag
atcagcaaagaagactttgtgcaacacactaaagcatcaaagcagaatgttttagatgga
acatccaaatggtcagctaaaataaatatcacagtggtttgtgctcagggtttacaagct
aaagacaaaacaggttcaagcgacccatatgtcactgttcaagttggaaaaaccaaaaga
aggactaaaacgatatttggcaacttaaatccagtatgggatgaaaaatttcattttgag
tgccacaactcaacagacagaataaaagtgcgagtttgggatgaggatgatgatattaaa
tctagagtaaagcaacacttcaagaaggagtctgatgactttcttggacaaacatttgtg
gatgtgaggacgcttagtggtgaaatggatgtatggtataatttagagaaaaggacagat
aaatcagctgtctctggtgcaattagactgaaaataaatgttgagatcaagggagaagag
aatgtgcccccttaccatgtgcagtacacatgtttacatgagaacttatttaaccaccta
acagaaattcagaataatggtattgttaagattcctgaggtaaagggtgatgaagcctgg
aaggtttactttgatgatgcggcacaggaaatagtcgatgaatttgccatgcgctacgga
atcgagtcaatttatcaagctatgacgcacttttcctgtctgtcttccaagtacatgtgt
cctggtgttcctgctgtcatgagtaccctactagcaaatatcaatgctttctatgctcac
acaacagcaacaacaaatgtttctgcttctgatcgttttgctgcaacaaattttggtaga
gaacggtttataaaattgttggatcagctgcacaactctttaagaattgatctatcaaaa
tacagggacaattttcctgctactaatccagaaaggcttcaagatttgaaatcaacagtg
gatcttctaacaagcatcacatttttccgtatgaaggttctcgaacttcagagtccacca
agagccagcgcagtagtaaaagactgtgtgcgagcatgtttagattctacctacaagtat
gtttttgtcaactgccatgatctgtactcacagctactagatcagggtaagaaacaagat
gttcctcgagaagatcaaggaccaaccataaaaaacctggatttctggccaaaccttatt
actttgatggttaccattattgatgaagataaaacatcttatacacctgtcttaaaccag
ttccctcaggagctaaatatgggtaaactcagtgcagaagtcatgtggcatctgtttgca
caagatatgaagtatgctatggaagaacatgaaaagcaccggctatgcaagagcaccgat
tacatgaatttgcacttcaaagtaaaatggttttataatgaatatgttaaagaactttct
gcattcaaagatacagtccctgaatattctctgtggtttgagacatttgttatacagtgg
ctggatgaaaatgaagatgtatcaatggaatttctccatggagctctaggaagagataaa
aaagatgggttccaggcaacatctgaacatgtacttttctcctgctctgttgttgatgtc
ttcacacaattgaatcaaagctttgagattatcaagaaactggagtgtccaaatccagaa
gctctgtctcatttcatgaagagatttgcaaatactatcaacaaagtgctccttcagtat
gcagtaattgtatccaatgatttcagctcatactgtggcaaagaaaatgtgccatgtatc
ctattgaacaacattcaacaactaagagttcagttggaaaagatgtttgagaacatggga
ggtaaagagttggatctcgatgcaagcgccatgctcaaggaacttcaggtgaagctgagt
ggagttctggatgaactgagctgtatatatggtgcaagtttccaggttgtaatagaagac
tgtgtgaaacaaatgagcgtggaattaaatcagatgaaaggaaatggaaatgcatctaca
aacaggaataatgcagcgatggatgcagagatagtactacggcctctcatggattttctg
gataaaaccttatctgtctcagcaaaaatatgcgagaagactgttttaaaacgggtcttg
aaagaattatggaaattggtactcaacagaatagaaaaacaaattgtcctgcctcctcta
acagatcaaactggggctcaaatgattttcagtgcagctaaagatcttggacaattatct
aaattaaaggaccatgttatacgagaagaagctaaaagcctttcacttcggcaatgttca
atcatggaagtagtattagcaaccatcaagcaatactttcatgctggtgggaatggtttg
aaaaagaacttcttggaaaagagcccagacctacagtctttgaaatacgcattaagcctt
tacacccaaacgactgatgctttgataaaaaaatatatagacacacaaacatgtcaaggt
cagtcgacagaaggctcagtaggggagatttctgttcaagtggatctgtttactcatcct
ggaaatggggagcacaaagtaacagtaaaaatcgtagcactcaacggcttactctggcaa
actactgctatgttccggccttttgtcgaagtctttgcattgggtcccagtctcagtgat
aaaaaaaggaaatttgggacaaagacaaagagcaacacttggtctccaaaatacaatgag
aattttcaattcattctgagtaatgaagagagcccacgggcgtatgaacttcatctctgt
gtgaaagactactgctttgccagagaggatcgcgttataggaatgactgttatccagctg
aagaatattgtggataaaggaaactgtgcctcgtggtatcctctgatgaaaaacatttgc
atggatgaaaccggactgaccattctgagaatcctgtctcagagatccaacgatgaagtt
gccaaggagtttgtaaagttgaaatctgacatccgatctccagaagagatctag

DBGET integrated database retrieval system