KEGG   Xenopus tropicalis (western clawed frog): 100494664Help
Entry
100494664         CDS       T01011                                 

Gene name
sphk2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Apelin signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100494664 (sphk2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100494664 (sphk2)
   04371 Apelin signaling pathway
    100494664 (sphk2)
   04020 Calcium signaling pathway
    100494664 (sphk2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100494664 (sphk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
7
AA seq 592 aa AA seqDB search
MEYRQSSETLLHGEFGVYPSKGIRYALSLTHTGLHIQRLVPKPEDDHRLVLPLSDMVGCH
TLRSHSSGDMFAYFSIYSYPLKKKKVTMGPSRTRQRLVRTFRVDEESEYNRNLAIAEKWA
TAIKCLIQEIPIGSETEFVPELLPRTRRLMLLVNPCGGRGNALQQCQSHILPMLTEAEIS
YNLIQTERQNHARELVQGISLEQWDGIIVISGDGLLYEVINGLMERPDWEDAIKMPVGIL
PCGSGNALAGAINYNAGFDQAMGSELLLNCILLLCRGTVIPMDLVSLTTCSGIRSFSFLS
VAWGFISDVDIESEKYRHMGSARFTVGTMVRVASLRTYRGRLSYLPVLDAHRPICRSITL
SPNGSLAPFQRSQLHRTISDIGLCEERNVMYKRSSTALDTNELPSFESPSPSSPTALHSS
SFNFDSLSDDPSYQDSVYSKDLKPQRHHQVNGPKDDLLPSLGQPLPKNWIIVEDNFVLVL
AIYQSHLGADLFTAPFSTFDDGLIHLFFVKAGISRAALVRLFLAMEKGTHFETECPYLTH
IPVRAFRLEPLTRKGIITVDGERVEYGPIQAQIHKGLSNLITGSCKVRLTPF
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggaatatcgacagtcatcagagaccctgctccatggagaattcggagtctacccatcc
aaaggtattcgctatgcacttagcttgacccacacaggtctccatattcagagactggtc
ccgaagcctgaagatgaccatcgcctcgttctgccgctcagtgacatggtgggctgtcac
actctgcgcagtcacagttccggggatatgtttgcctatttttccatttattcctatccg
ctcaagaagaaaaaggtcaccatgggacctagccgcacccgacagaggttggttcgcaca
ttccgcgtagatgaagaatcggaatataacagaaaccttgctattgctgagaagtgggca
accgctataaagtgtttgattcaggaaattcccataggcagtgaaacagaatttgttcct
gagcttctgcccagaacccggaggttaatgcttttggtaaatccatgtggaggaagaggg
aatgccctacagcagtgtcagagccacatactgcccatgctgacggaggcagaaatcagc
tataatctcatacagacagagaggcagaaccacgcgcgagagctagtgcaaggaatcagt
ttggagcaatgggacggtataattgtcatctctggagacggactactctatgaggttatt
aatggtttgatggaacgccccgactgggaagatgcaataaaaatgcctgtgggaattctc
ccctgtggctcaggaaatgccttggcgggagcgatcaactacaatgcagggtttgatcag
gcaatggggtctgagctgctgctaaactgcatcttgctgctgtgccgtggtactgttatt
cctatggacctggtgtctttgacaacctgctctggaatccgttctttttcattccttagt
gtagcctggggttttatctccgatgtggacatagagagcgagaagtaccgtcacatgggt
tcagctcgcttcacagtaggaacgatggtaagggtagcctccctgcggacttatagaggc
cgcctttcctatctgccagttttggatgcccatcgcccaatttgcaggagcatcactttg
tctcctaatgggagtctggctccatttcagcgctctcagttgcaccgtaccatatcagac
attggactgtgcgaggagaggaatgtgatgtataagcgcagttctactgctcttgacaca
aatgagttgcccagttttgagtcaccttctccaagttcacctacagccttgcactcttcc
agcttcaactttgactctctctcggatgacccttcatatcaggattctgtgtattccaaa
gacttaaagcctcagaggcaccatcaggttaatggacccaaggacgacctcttgccttct
ttggggcaacctctgcctaagaactggataattgttgaagataattttgtcttagtgttg
gccatttatcagagccatttaggggctgatttgttcacggctccattttccacttttgat
gatggtttgatccaccttttctttgtaaaagcaggtatatcccgggcagcccttgtgcgc
ctcttcctagccatggaaaaaggtacacactttgagacggaatgtccatacctcacccac
attcctgttagagccttccgcttggagcctctcacaagaaagggaattattactgtagat
ggagagcgggtggaatatgggcctatccaggctcagatacacaaaggactaagtaacctt
atcactggatcttgcaaagtccgtttgactccattctaa

DBGET integrated database retrieval system