KEGG   Xenopus tropicalis (western clawed frog): 100495122Help
Entry
100495122         CDS       T01011                                 

Definition
(RefSeq) angiopoietin-2-like
  KO
K05466  
angiopoietin 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 331 aa AA seqDB search
MLFCAAAVLLIVLRCFDIGHATVRKPVESTGKKQYQVQHGACSYTFLLPEIESCRSASSN
SYVSNSVQRDAPLDYDDSIQRLQVLENIMENNTQWLIKLESYIQDNMKKEIVEIQQHAVH
NQTAAMIEIGTSLLNQTVEQSKKLTHVETQVFNQTTRLELQLLENSLSTNKLERQISDQT
SEITKLQDKNSFLEKKVLGMEDKHTAQLQTIKEEKDKLQDLVLKQNTIIEDLEKQLVTAS
ANNSFLQKQQHDLMETVHNLLTRMAPQNAPRSSFVAKEEQLAFKDCAEAYKSGFTANGIY
TLTILNTTDQAKLPPHHQLEAPVQELAFQIY
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgttgttctgtgctgcggctgtattactgattgtacttagatgctttgatattgggcat
gcaacagttcgcaaacctgtggaaagtacagggaagaagcagtaccaggtccagcatgga
gcttgcagctacacatttttactgccagagatagaaagttgccgctcagcctcttctaac
tcctatgtatcaaattcggtgcagagagatgctccacttgactatgatgactcaatacag
aggctacaggttttagaaaacatcatggaaaacaatacacagtggttaatcaagcttgaa
agttatatccaagataacatgaagaaagaaattgtggagatacagcagcacgcagtacat
aatcaaactgctgcaatgattgagataggcaccagtcttttaaatcagacagtggagcaa
tcaaagaagttaacacatgtggagacacaggtgtttaaccaaaccacacgacttgagctt
cagcttctggaaaattccctctcaacaaacaaattagagagacaaatttcagaccagact
agtgaaataacaaagctgcaagacaagaatagctttttagaaaagaaagtcctaggcatg
gaggacaagcacacggcacaacttcagacaataaaggaagaaaaggataaacttcaagat
ttggtgctgaagcaaaatactattattgaggatctagaaaagcaacttgtaacagcatca
gcaaataactcctttctgcaaaaacagcagcatgacttgatggaaacggtacacaatctc
ctgactaggatggcacctcagaatgcccccagaagctcttttgtggccaaagaggagcag
cttgcttttaaagactgtgctgaggcatataaatcaggattcacagcaaatgggatttac
acattaacaatcctcaacactacagaccaagcaaagctcccgccacaccaccagctggaa
gccccagttcaagaacttgctttccaaatttattaa

DBGET integrated database retrieval system