KEGG   Xenopus tropicalis (western clawed frog): 100495122Help
Entry
100495122         CDS       T01011                                 

Gene name
angpt2, ang-2, ang2
Definition
(RefSeq) angiopoietin 2
  KO
K05466  angiopoietin 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100495122 (angpt2)
Cytokines and growth factors [BR:xtr04052]
 Growth factors
  Growth factors (RTK binding)
   100495122 (angpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SHE3 CENP-H MtrB
Motif
Other DBs
NCBI-GeneID: 100495122
NCBI-ProteinID: XP_017949837
Xenbase: XB-GENE-487765
Position
5
AA seq 120 aa AA seqDB search
MEDKHTAQLQTIKEEKDKLQDLVLKQNTIIEDLEKQLVTASANNSFLQKQQHDLMETVHN
LLTRMAPQNAPRSSFVAKEEQLAFKDCAEAYKSGFTANGIYTLTILNTTDQAKVSILRRK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggaggacaagcacacggcacaacttcagacaataaaggaagaaaaggataaacttcaa
gatttggtgctgaagcaaaatactattattgaggatctagaaaagcaacttgtaacagca
tcagcaaataactcctttctgcaaaaacagcagcatgacttgatggaaacggtacacaat
ctcctgactaggatggcacctcagaatgcccccagaagctcttttgtggccaaagaggag
cagcttgcttttaaagactgtgctgaggcatataaatcaggattcacagcaaatgggatt
tacacattaacaatcctcaacactacagaccaagcaaaggtaagcatattgagaagaaaa
taa

DBGET integrated database retrieval system