KEGG   Xenopus tropicalis (western clawed frog): 100495320Help
Entry
100495320         CDS       T01011                                 

Gene name
irs1, irs-1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  
insulin receptor substrate 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
FoxO signaling pathway
Autophagy - animal
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100495320 (irs1)
   04150 mTOR signaling pathway
    100495320 (irs1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100495320 (irs1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100495320 (irs1)
   04920 Adipocytokine signaling pathway
    100495320 (irs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
5
AA seq 1091 aa AA seqDB search
MASPTDPQAQENFSDVRKVGYLRKPKSMHKRFFVLRSASESGLARLEYYENEKKWRHKSG
APKRSIPLESCFNINKRADSKNKHLVALYTKEECFAIAAECEQEQDGWYQALVDLHNRGK
THHQHHNHDGATNGVHDGLNGDDVYGEVTPPGLAFKEVWQVIMKPKGLGQLKNLVGIYRL
CLTNRTISLVKLNSDAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGAGEFWMQVDDSVV
AQNMHETILEAMKALSDEFRPRSKSQSSSNCSNPISVPLRRHHLNHPPPSQVGLNRRART
ESVTATSPAGGVAKHGSSSSFRVRASSDGEGTMSRPASMEGSPVSPSASRAQSHRHRGSS
RLHPPLNHSRSIPMPATRCSPSATSPVSLSSSSTSGHGSTSDCMCPRRSSASVSGSPSDG
GFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPAREEELNNYICMGKSGSHLQRSQQQRYQ
LSRGEEHPDFDKVFRKRTHSSGTSPPTVSHQKTPSQSSIEEYTEMMPAHPVRLTSFRHSA
FVPTYSYPEECLDLHLEGSRANHTDDGYMPMSPGVAPVPTKSNDYMPMSPKSVSAPQQII
NPRRHSAVDSNGYMMMSPSGSCSPDSTNYSKIWTNGTNPKLSIDSIEGKLPCSDYINMSP
ASGSTTSTPPDSYLNSIEESTKPVYSYFSLPRSFKHVHRKSEDGNLRITANSGHNLYTED
SSSSSTSSDSLGGQDPQQPRKGETCIQGKRLTRPTRLSLENSSKASTLPRAREPALPPEP
KSPGEYVNIEFNDKVFSGGLMPSMCPLPFVQSRVVPQRENLSEYMNMDLGVWRAKTSYAS
TSSSSYEPPYKPVSSVCPTETCSSSRPPIRGKTNSRDYMSMQLSALCSDYSQVPPTRITA
KPITLSSNKSNYAEMSSGGVSDNIPAIPQTSNSSLSEASRSSLLGQGSGPSAFTRVSLSP
NRNQSAKVIRAGDPQGRRRHSSETFSSTPTTARVTSGPVSGEDVKRHSSASFENVWLKPG
EIARRDSLQPSDHTHNGLNYIDLDLAKDLSGLDHCNSHQSGVSHPSDDLSTYASITFHKL
EEHRNQAETEE
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggctagccccacagatccacaggctcaggagaacttttctgatgtcagaaaggtgggc
tatctaaggaaacctaagagcatgcacaagaggttttttgtgctcaggtctgccagtgag
tcaggtttggcccgtttggagtattatgaaaatgagaaaaagtggaggcataagtctggg
gccccaaagaggtcaatccctcttgagagctgctttaatattaacaagagggctgattca
aaaaacaaacatttggttgctttgtacacaaaggaggaatgctttgcaattgctgctgaa
tgtgaacaagaacaggatggttggtatcaggctctagtggatcttcacaaccgtggtaag
acccaccaccaacaccataaccatgacggtgcaaccaatggtgtacatgatggtttaaat
ggagatgacgtttatggggaggttactcctccaggactggccttcaaagaggtatggcag
gtgatcatgaagcccaagggtttagggcaacttaagaatttagttggtatttaccgcctg
tgcctcaccaaccgaacaataagtttggtaaaactgaactctgatgcagccgctgtggta
ttgcaacttatgaatataaggagatgtgggcattcagaaaattttttctttatagaagtg
ggtcgttcagcagtcaccggagctggtgaattctggatgcaagtggatgattcagtagtt
gctcaaaacatgcatgaaaccatactagaagctatgaaagctctgagcgatgaatttcgg
cctcggagtaagagtcagtcttcatctaactgctctaatcctatatctgtacctcttagg
aggcatcaccttaatcatccaccacccagccaggtaggactaaatagaagagctcgtaca
gagagtgttactgccacatcacctgcagggggtgtggcaaagcatggatcatcctcctct
ttcagagtccgggcatctagtgatggagaaggaacaatgtcaaggccagcctccatggaa
gggagcccagtaagtcccagtgctagcagagctcagtcgcaccggcatcggggaagttct
cgacttcacccgcctcttaaccatagtcggtctataccaatgccagcaactcgctgctct
ccatcggctaccagccctgtcagcttgtcctccagtagtaccagtggacatggttccact
tctgattgcatgtgccctcgaagatccagtgcctctgtttctggttcacccagtgatggt
ggttttatttcttcagatgaatatgggtctagcccttgtgactttagaagttcttttcgc
agtgtaaccccagattctttgggccacactccaccagctagggaagaagaactaaataac
tatatttgcatgggcaaatccggtagtcatctccagagaagtcagcagcagaggtaccag
ctaagtcgaggggaagagcaccctgactttgataaggtttttagaaagaggactcactcc
tcaggaacatcacctcctacagtttcacaccagaagacaccatcacagtcctctattgag
gaatatacagagatgatgcctgctcatcctgttcgtttaacatcatttagacattctgca
tttgtacccacctactcctatccagaagagtgcctggacctccatttagagggtagcaga
gctaaccacacagatgacggatacatgcctatgtcacctggtgttgctcctgtgcctaca
aaatcaaatgactatatgcctatgagccctaagagtgtgtcggcccctcaacagatcatt
aacccaagacggcactctgctgtagattcaaatggttatatgatgatgtcacccagtggt
agctgttctccggatagcaccaattacagcaagatatggaccaatggtaccaatccaaag
ttgtccatagatagcattgagggcaaactgccttgcagtgactacattaatatgtctcct
gctagtggctctactacaagcacgcctccagactcttatctgaattctattgaagagtcg
accaagcctgtatattcctacttttccctgcccaggtccttcaaacatgttcacaggaaa
agtgaagatggcaatttgcgcatcactgcaaattctggacataatctatacactgaggac
tcttcctcctcttccacaagcagtgatagtctaggggggcaggaccctcagcagcctaga
aaaggggagacctgcattcaagggaagagattgaccagacccaccaggctttcattggaa
aacagcagtaaggccagcacactgccaagggcgagagaacctgctttgcccccagagcca
aaaagtcctggggagtatgttaatatagagtttaacgacaaggtattttcagggggcttg
atgccttccatgtgtccccttccttttgtgcagagcagagttgtgcctcaaagagagaac
ttgtctgaatacatgaacatggatcttggagtttggagagctaaaacttcctatgcttcc
acctcatcttcatcatatgaaccaccatacaagccggtcagctcagtgtgccctactgaa
acttgcagtagtagtcgaccacctattagaggaaagacaaactcacgagactatatgagc
atgcaacttagtgctctgtgttcagattacagccaagttccacctaccagaataactgcc
aaacccattactctttcttctaataaaagtaattatgcagagatgtcaagtggcggagtt
tctgataatattcctgctattccccaaacttctaactcaagcctatctgaagcatctcgc
tcttcccttttgggccagggctctggccctagcgcctttactcgggtcagtctaagccca
aaccgcaatcagagtgccaaagtcatcagggccggggacccacagggtaggaggaggcac
agctcagagacattctcctctactcctactacagccagagttacttctggcccagtttct
ggggaggatgtcaagagacatagttctgcctcctttgaaaatgtgtggctaaaaccagga
gagattgccaggagagattcccttcagccttctgatcacacacataatggcctgaattat
attgacttagatctagctaaggacttgagtggcctggatcattgcaactcccaccaatct
ggagtaagccacccatcagatgacctgagcacatacgccagcatcactttccacaagcta
gaggagcaccggaatcaggcagaaacagaagaataa

DBGET integrated database retrieval system