KEGG   Xenopus tropicalis (western clawed frog): 100495320Help
Entry
100495320         CDS       T01011                                 

Definition
insulin receptor substrate 1-B-like
Orthology
K16172  
insulin receptor substrate 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100495320
   04150 mTOR signaling pathway
    100495320
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100495320
   04920 Adipocytokine signaling pathway
    100495320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1091 aa AA seqDB search
MASPTDPQAQENFSDVRKVGYLRKPKSMHKRFFVLRSASESGLARLEYYENEKKWRHKSG
APKRSIPLESCFNINKRADSKNKHLVALYTKEECFAIAAECEQEQDGWYQALVDLHNRGK
THHQHHNHDGATNGVHDGLNGDDVYGEVTPPGLAFKEVWQVIMKPKGLGQLKNLVGIYRL
CLTNRTISLVKLNSDAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGAGEFWMQVDDSVV
AQNMHETILEAMKALSDEFRPRSKSQSSSNCSNPISVPLRRHHLNHPPPSQVGLNRRART
ESVTATSPAGGVAKHGSSSSFRVRASSDGEGTMSRPASMEGSPVSPSASRAQSHRHRGSS
RLHPPLNHSRSIPMPATRCSPSATSPVSLSSSSTSGHGSTSDCMCPRRSSASVSGSPSDG
GFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPAREEELNNYICMGKSGSHLQRSQQQRYQ
LSRGEEHPDFDKVFRKRTHSSGTSPPTVSHQKTPSQSSIEEYTEMMPAHPVRLTSFRHSA
FVPTYSYPEECLDLHLEGSRANHTDDGYMPMSPGVAPVPTKSNDYMPMSPKSVSAPQQII
NPRRHSAVDSNGYMMMSPSGSCSPDSTNYSKIWTNGTNPKLSIDSIEGKLPCSDYINMSP
ASGSTTSTPPDSYLNSIEESTKPVYSYFSLPRSFKHVHRKSEDGNLRITANSGHNLYTED
SSSSSTSSDSLGGQDPQQPRKGETCIQGKRLTRPTRLSLENSSKASTLPRAREPALPPEP
KSPGEYVNIEFNDKVFSGGLMPSMCPLPFVQSRVVPQRENLSEYMNMDLGVWRAKTSYAS
TSSSSYEPPYKPVSSVCPTETCSSSRPPIRGKTNSRDYMSMQLSALCSDYSQVPPTRITA
KPITLSSNKSNYAEMSSGGVSDNIPAIPQTSNSSLSEASRSSLLGQGSGPSAFTRVSLSP
NRNQSAKVIRAGDPQGRRRHSSETFSSTPTTARVTSGPVSGEDVKRHSSASFENVWLKPG
EIARRDSLQPSDHTHNGLNYIDLDLAKDLSGLDHCNSHQSGVSHPSDDLSTYASITFHKL
EEHRNQAETEE
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggctagccccacagatccacaggctcaggagaacttttctgatgtcagaaaggtgggc
tatctaaggaaacctaagagcatgcacaagaggttttttgtgctcaggtctgccagtgag
tcaggtttggcccgtttggagtattatgaaaatgagaaaaagtggaggcataagtctggg
gccccaaagaggtcaatccctcttgagagctgctttaatattaacaagagggctgattca
aaaaacaaacatttggttgctttgtacacaaaggaggaatgctttgcaattgctgctgaa
tgtgaacaagaacaggatggttggtatcaggctctagtggatcttcacaaccgtggtaag
acccaccaccaacaccataaccatgacggtgcaaccaatggtgtacatgatggtttaaat
ggagatgacgtttatggggaggttactcctccaggactggccttcaaagaggtatggcag
gtgatcatgaagcccaagggtttagggcaacttaagaatttagttggtatttaccgcctg
tgcctcaccaaccgaacaataagtttggtaaaactgaactctgatgcagccgctgtggta
ttgcaacttatgaatataaggagatgtgggcattcagaaaattttttctttatagaagtg
ggtcgttcagcagtcaccggagctggtgaattctggatgcaagtggatgattcagtagtt
gctcaaaacatgcatgaaaccatactagaagctatgaaagctctgagcgatgaatttcgg
cctcggagtaagagtcagtcttcatctaactgctctaatcctatatctgtacctcttagg
aggcatcaccttaatcatccaccacccagccaggtaggactaaatagaagagctcgtaca
gagagtgttactgccacatcacctgcagggggtgtggcaaagcatggatcatcctcctct
ttcagagtccgggcatctagtgatggagaaggaacaatgtcaaggccagcctccatggaa
gggagcccagtaagtcccagtgctagcagagctcagtcgcaccggcatcggggaagttct
cgacttcacccgcctcttaaccatagtcggtctataccaatgccagcaactcgctgctct
ccatcggctaccagccctgtcagcttgtcctccagtagtaccagtggacatggttccact
tctgattgcatgtgccctcgaagatccagtgcctctgtttctggttcacccagtgatggt
ggttttatttcttcagatgaatatgggtctagcccttgtgactttagaagttcttttcgc
agtgtaaccccagattctttgggccacactccaccagctagggaagaagaactaaataac
tatatttgcatgggcaaatccggtagtcatctccagagaagtcagcagcagaggtaccag
ctaagtcgaggggaagagcaccctgactttgataaggtttttagaaagaggactcactcc
tcaggaacatcacctcctacagtttcacaccagaagacaccatcacagtcctctattgag
gaatatacagagatgatgcctgctcatcctgttcgtttaacatcatttagacattctgca
tttgtacccacctactcctatccagaagagtgcctggacctccatttagagggtagcaga
gctaaccacacagatgacggatacatgcctatgtcacctggtgttgctcctgtgcctaca
aaatcaaatgactatatgcctatgagccctaagagtgtgtcggcccctcaacagatcatt
aacccaagacggcactctgctgtagattcaaatggttatatgatgatgtcacccagtggt
agctgttctccggatagcaccaattacagcaagatatggaccaatggtaccaatccaaag
ttgtccatagatagcattgagggcaaactgccttgcagtgactacattaatatgtctcct
gctagtggctctactacaagcacgcctccagactcttatctgaattctattgaagagtcg
accaagcctgtatattcctacttttccctgcccaggtccttcaaacatgttcacaggaaa
agtgaagatggcaatttgcgcatcactgcaaattctggacataatctatacactgaggac
tcttcctcctcttccacaagcagtgatagtctaggggggcaggaccctcagcagcctaga
aaaggggagacctgcattcaagggaagagattgaccagacccaccaggctttcattggaa
aacagcagtaaggccagcacactgccaagggcgagagaacctgctttgcccccagagcca
aaaagtcctggggagtatgttaatatagagtttaacgacaaggtattttcagggggcttg
atgccttccatgtgtccccttccttttgtgcagagcagagttgtgcctcaaagagagaac
ttgtctgaatacatgaacatggatcttggagtttggagagctaaaacttcctatgcttcc
acctcatcttcatcatatgaaccaccatacaagccggtcagctcagtgtgccctactgaa
acttgcagtagtagtcgaccacctattagaggaaagacaaactcacgagactatatgagc
atgcaacttagtgctctgtgttcagattacagccaagttccacctaccagaataactgcc
aaacccattactctttcttctaataaaagtaattatgcagagatgtcaagtggcggagtt
tctgataatattcctgctattccccaaacttctaactcaagcctatctgaagcatctcgc
tcttcccttttgggccagggctctggccctagcgcctttactcgggtcagtctaagccca
aaccgcaatcagagtgccaaagtcatcagggccggggacccacagggtaggaggaggcac
agctcagagacattctcctctactcctactacagccagagttacttctggcccagtttct
ggggaggatgtcaagagacatagttctgcctcctttgaaaatgtgtggctaaaaccagga
gagattgccaggagagattcccttcagccttctgatcacacacataatggcctgaattat
attgacttagatctagctaaggacttgagtggcctggatcattgcaactcccaccaatct
ggagtaagccacccatcagatgacctgagcacatacgccagcatcactttccacaagcta
gaggagcaccggaatcaggcagaaacagaagaataa

DBGET integrated database retrieval system