KEGG   Xenopus tropicalis (western clawed frog): 100495399Help
Entry
100495399         CDS       T01011                                 

Definition
acrosin-like
Orthology
K01317  
acrosin [EC:3.4.21.10]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.10  acrosin
     100495399
Peptidases [BR:xtr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100495399
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 386 aa AA seqDB search
MTRQTFNLLPIFFIFFIFYLIYESESAIGGICGNRPLFNKGSRIVGGQNSPPGKWPWMVS
IQSPTGKEFSHLCGGSVLNEIWVLTAAHCFKHLERKEETKSWRLVFGANNLKVLESSVQI
RKIKEVVQPKAYNPTTEANDITLLRLDKPIVFTDYVQPACFPTEFANVEKKTDCYIAGWG
VLDEESGEPSEILQEARVHQIDSKKCNSKDWYDGSIGEYNLCAGHEKGGIDSCQGDSGGP
LMCKTQKSRTYAVVGITSWGSGCARGKKPGVYTSTKYFIKWIASKVETDEKPKIRKKRSL
LKNIILPNGQLPDAEIEELTQTQTQGTETNPVRPTAQIQEFQYGREKGTQVQSGPIEGKL
KPEIAVQVPTENILKRIMSWLLTDMR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacaagacagactttcaatttattaccaatcttttttatattctttatattttatctt
atttatgaatctgagagtgccatcggcggcatttgcggaaaccgacctttatttaataag
ggctcccggattgttggaggacaaaattccccacctgggaagtggccatggatggtgagc
atacagagccccactgggaaagaattctcacatctttgcggaggaagcgtcttgaatgaa
atttgggttctgacagcagcgcattgttttaagcatctggaaaggaaggaagaaactaaa
tcttggaggctcgtatttggagcaaacaacttaaaagttctagaatcatcagtgcaaatc
cgaaaaataaaagaagtcgtacagcccaaagcctataatccaacgactgaggcaaatgac
attactctgttgcggttagacaagcctattgtgtttacagactatgtacaaccggcttgt
ttcccaacagagtttgctaatgtcgagaagaagaccgactgttacattgcaggatgggga
gttctggatgaagaatctggagaaccatcagaaattttgcaagaggcccgtgtgcatcaa
atagattccaaaaaatgtaactccaaagactggtatgatggctccataggggaatacaac
ctatgtgcaggccatgagaaaggaggcatcgacagctgccagggagacagcggaggacct
ttgatgtgcaaaacgcagaaatcaagaacctacgctgtagttggaatcacaagctgggga
tcaggctgtgcaagaggcaaaaagccaggtgtttacacttccaccaaatactttattaag
tggatcgctagcaaagttgagacagatgagaaaccgaaaatcaggaagaaacgatctttg
ttgaaaaacatcattcttcccaatggacaacttcctgatgctgagattgaagagctaacc
cagacccaaacccaaggaactgaaacaaatcctgtgcgaccaactgcacaaatacaagag
tttcagtatggcagagaaaaagggacgcaagttcagtctggaccaatagaaggaaagctt
aaacctgaaatagcagtgcaagtaccaacagaaaacattctgaaaagaattatgagttgg
ttacttacggacatgcgatag

DBGET integrated database retrieval system