KEGG   Xenopus tropicalis (western clawed frog): 100495429Help
Entry
100495429         CDS       T01011                                 

Definition
aldehyde oxidase-like
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100495429
   00350 Tyrosine metabolism
    100495429
   00380 Tryptophan metabolism
    100495429
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100495429
   00760 Nicotinate and nicotinamide metabolism
    100495429
   00830 Retinol metabolism
    100495429
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100495429
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100495429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1321 aa AA seqDB search
MLNPVDSHTLIFFVNGRKIVEENADPEELLLPYLRKKLLLTGTKYGCGGGGCGACTVMVS
TIHPVSKKILHFSANACLLPICSMHGAAVTTIEGIGSTTTKLHPVQERIAKAHGSQCGFC
TPGMVMSVYSLLRNHPEPTMEQIYESLGGNLCRCTGYRPIVDGCRTFCNKTDCCQVKENG
MEKISTPDTVDNILTGLFKEEQFLPLDPTQELIFPPELLLMDKEKKEKLFFQGGRMTWIS
PSSLQELLQLKATYPKAPLVVGNTIVGRCPEMKFRGIFHPVIISPSRIPELNFVIHKDDG
ITVGAACSLTVLKEALKEVVTQQPEEKTKLFHALLQQLETLGGPQIRNTASLGGNIISRS
PTSDLNPVLAAGNCILTVAAIDGTRQMPLDEAFFAHSLKAEEVLVSVHLPYSKKGDHYSV
FRQAQRRENALPIVTAGMKVQFEENTDIIKVIRIFYGGVGPTTVFAKTTCQDLIGKHWDD
HMLSEACRLMVHEITLSPSAPGGMVEYRRTLTISFFFKFYLEVLQRLNHMGTHYSDVSAL
NSFETLCNENVQLYQDVSSRQSVQDPIGRPIMHYSGIKHATGEAVYCDDMPCVDGELFLY
FVTSTKAHAKIVSLDFSEALAQPGVVDVVTTEDCPGTCKSMFEEGEVLCVGQIICAVLAD
TPARAKKAAAAVKVVYENLEPVILTIQEAIEHNSFFKPQRKLENGNVEEAFKSADQIQEG
EIYIGGQEHFYMETQSIRVLPKGEDKEMDVYVSTQDPTYIQNLIATILNVPSNRITCHVK
RVGGAFGGKTTKTGNIAAITAVAANKYVLFKSHSKVSETRRAVRCVFERGDDMLITGGRH
PFLGKYKVGFMNDGRITAVDVAYFSNAGCTPDDSVLVVEIALMNMDSAYRLPNVRCTGTA
CKTNLPSNTAFRGFGYPQAAFVTETWISEVAIKCRIPPEKVREMNLYKDISQTHFRQEIL
ARTLGMCWNECMEKSSYNSRRLAIENFNKDNYWKKKGLAIIPMKFPIGSLAKFFGQAAAL
VHIYLDGSVLVTHGGIEMGQGVHTKIMQIASRELGIPLSYIHICETNTSSVPNTQVSGGS
LGTDVNGMAVKNACEILMQRLLPIRSKNPKSSWKEWVTEAYMQSVSLSATGFCRSTGEGN
PVHYCVYGVACSEVEIDCLTGDHKNLRTDIVIDFGCSINPAVDIGQIEGAFVQGLGLFTI
EELKFSPNGVLYTRGPAQYKIPSVRDIPEQFNVSLLSNVPNSCAIYSSKGVGEPALFLGS
SIYFAIKDAVLSARRERGMSELFTLNSPATPEKIRMACGDQFTDMIPQNVPGSYVPWAVN
V
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaccctgtagattcacatactctcatattttttgtgaatggacggaagattgtt
gaggaaaatgccgatcctgaagagttgcttctaccctacttaaggaagaaacttcttctc
acgggaacaaaatatggatgtggaggtggtggatgtggtgcttgcacagtaatggtatca
accatccatcctgtttccaagaagattctacatttctcagccaatgcctgcctactgcca
atatgctccatgcatggtgcagccgttacaaccatcgagggcatcggaagcacaactacc
aaattgcatcctgtgcaggagagaatagctaaagctcatggttcccagtgtggtttctgt
actcctgggatggtgatgtctgtgtatagcttactaaggaatcatccagaaccaactatg
gagcagatatatgaaagcctaggaggtaatctctgtcgctgtactggttacaggccaata
gtggatggatgccgaactttctgtaataaaactgattgttgccaagtcaaagagaatggg
atggaaaagatttctacacctgatacagtagataacatcctcacaggtttgtttaaagaa
gaacagtttttacctcttgatccaacacaggaattaatatttccccctgaattactgcta
atggataaagaaaaaaaagaaaaactctttttccaaggggggcgtatgacttggatatca
ccttccagtcttcaggaacttctgcaactgaaagcaacatatccgaaggctccacttgtt
gtgggaaacaccatcgtcggtaggtgtcccgaaatgaagttcagaggaatttttcatcct
gttataatttccccttcaagaataccggagctcaattttgtaattcataaggatgatgga
ataacagtaggggcagcttgcagtttaacagtgctgaaagaagctctaaaggaagttgtc
acccaacaaccagaggaaaagaccaaattatttcatgcccttctacagcaacttgaaaca
ctcggaggtccacagataaggaacacagcatctctaggaggaaacattataagccgttct
ccaacatctgatctaaacccagttctggctgcaggcaactgcattctaactgtggcagca
atagatggaactaggcagatgccattggatgaggcattttttgctcattcgttgaaggct
gaagaggttttagtatcagttcatttaccttattccaagaagggggatcattactccgtt
ttcagacaggcccagagacgagagaatgcattgcctattgtcactgctggaatgaaagtt
cagtttgaagaaaacactgacataattaaagtcattcgtatcttctatggtggtgttggt
ccaaccactgtttttgcaaagaccacatgtcaagatctgataggaaagcactgggatgac
cacatgctaagtgaagcctgcagactcatggtgcatgagattaccctttctccctcagcc
ccgggaggcatggtagaataccgcaggactctgaccatcagcttttttttcaaattctac
cttgaggtgttacagagacttaaccacatgggcactcattattcagatgtcagtgctctt
aacagttttgaaacattatgcaatgaaaatgtccagctgtaccaggatgtatcttcacgt
caatcagtacaagatcccatcggacggcctatcatgcattattctggaataaaacatgct
actggcgaggctgtatactgtgatgacatgccctgtgtagatggcgaactgtttttgtat
tttgtcaccagtacaaaggctcatgcaaaaattgtgtcactggatttctcggaggccttg
gcccagccaggagtggtggatgttgtaacaacagaagattgtccaggcacatgcaaatct
atgtttgaggaaggggaggtgctttgcgtgggtcagatcatctgtgcagttttggctgac
actcctgccagagctaaaaaggcagctgctgcagttaaagtggtgtatgagaatctggag
ccggtcattctaaccattcaggaagccattgaacacaattcattttttaagccacaaaga
aagctggagaatggaaatgtggaagaagcatttaaatctgctgatcaaatacaggaaggt
gaaatatacattggaggacaggagcatttctacatggagacccagagtatccgtgttttg
cctaagggagaggacaaagagatggatgtgtatgtgtctacacaggatccaacatatatt
cagaatcttatagctacaatactgaacgtgccatcaaacaggataacatgccacgtgaaa
agggttggaggagcttttggaggcaaaaccacaaagacaggaaatattgcagcaattact
gctgtagcagcaaacaagtatgtcttatttaaatctcattctaaagtaagcgagacacgg
agggctgttcggtgtgttttcgagcgtggtgatgatatgttaataacaggaggaagacac
ccctttcttgggaaatataaagtgggattcatgaacgacgggcggattacagcagtggat
gtggcttacttcagtaatgcagggtgtaccccggatgactctgttcttgttgttgagatt
gcactgatgaacatggatagtgcttacaggctgcccaatgtgcgatgtacagggactgcc
tgcaagacaaacctcccctcaaacactgccttccgaggatttggctacccacaggctgcc
tttgtcacagaaacttggatcagtgaagtggctataaagtgcagaattccacctgaaaag
gtcagggaaatgaatctgtataaggatatcagccaaacacatttcaggcaggaaatacta
gccaggactctgggaatgtgttggaatgaatgcatggagaagtcttcctacaacagcaga
agactggccattgagaatttcaataaagacaattattggaagaaaaagggccttgccatt
attcctatgaaatttcctattggatcactggcaaagttctttggacaggctgctgctctt
gtccacatctatttggatggatcagtgttggtgacccatggtggaatagagatggggcaa
ggagttcatacaaagattatgcagattgccagtcgtgagttgggcatccctctatcatac
atccatatttgtgagaccaacacaagttctgttccaaacactcaggtctctggaggctcc
ctagggacagatgtcaatggcatggcagtgaagaatgcatgtgaaatccttatgcaacgc
cttctgccaattagaagtaagaaccctaaaagttcctggaaggaatgggtaactgaagcc
tatatgcagtcagtcagcctctcagctacaggattctgcaggtctaccggagagggcaac
ccagttcactactgtgtgtacggagttgcttgctctgaggtagaaattgactgtctcact
ggagatcacaagaacctcaggacagacattgttatagattttggttgcagcatcaaccca
gctgtggatattggacagattgaaggtgcatttgtgcaaggtcttggactatttacgatt
gaagaactcaagttttctccaaacggagtgctctatacccgtggcccagctcaatataag
atcccttctgtccgtgatatccctgaacaatttaatgtgtcactgctttccaatgttccc
aacagctgtgccatatactcttcaaagggagttggagagccagctctgtttttggggtcc
tcaatctattttgctataaaagatgcagtgttatcagcccgaagagaaagagggatgtct
gagctctttacgctaaacagtccagcaactccagagaaaataagaatggcttgtggggac
cagttcacagacatgattccacagaatgtccctggctcttatgtgccctgggctgtcaat
gtgtaa

DBGET integrated database retrieval system