KEGG   Xenopus tropicalis (western clawed frog): 100495429Help
Entry
100495429         CDS       T01011                                 

Gene name
aox1
Definition
(RefSeq) aldehyde oxidase 1
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00280  Valine, leucine and isoleucine degradation
xtr00350  Tyrosine metabolism
xtr00380  Tryptophan metabolism
xtr00750  Vitamin B6 metabolism
xtr00760  Nicotinate and nicotinamide metabolism
xtr00830  Retinol metabolism
xtr00982  Drug metabolism - cytochrome P450
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100495429 (aox1)
   00350 Tyrosine metabolism
    100495429 (aox1)
   00380 Tryptophan metabolism
    100495429 (aox1)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100495429 (aox1)
   00760 Nicotinate and nicotinamide metabolism
    100495429 (aox1)
   00830 Retinol metabolism
    100495429 (aox1)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100495429 (aox1)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100495429 (aox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Fer2_2 CO_deh_flav_C Ald_Xan_dh_C Fer2
Motif
Other DBs
NCBI-GeneID: 100495429
NCBI-ProteinID: NP_001265676
UniProt: M1ZMQ0
Position
9
AA seq 1321 aa AA seqDB search
MLNPVDSHTLIFFVNGRKIVEENADPEELLLPYLRKKLLLTGTKYGCGGGGCGACTVMVS
TIHPVSKKILHFSANACLLPICSMHGAAVTTIEGIGSTTTKLHPVQERIAKAHGSQCGFC
TPGMVMSVYSLLRNHPEPTMEQIYESLGGNLCRCTGYRPIVDGCRTFCNKTDCCQVKENG
MEKISTPDTVDNILTGLFKEEQFLPLDPTQELIFPPELLLMDKEKKEKLFFQGGRMTWIS
PSSLQELLQLKATYPKAPLVVGNTIVGRCPEMKFRGIFHPVIISPSRIPELNFVIHKDDG
ITVGAACSLTVLKEALKEVVTQQPEEKTKLFHALLQQLETLGGPQIRNTASLGGNIISRS
PTSDLNPVLAAGNCILTVAAIDGTRQMPLDEAFFAHSLKAEEVLVSVHLPYSKKGDHYSV
FRQAQRRENALPIVTAGMKVQFEENTDIIKVIRIFYGGVGPTTVFAKTTCQDLIGKHWDD
HMLSEACRLMVHEITLSPSAPGGMVEYRRTLTISFFFKFYLEVLQRLNHMGTHYSDVSAL
NSFETLCNENVQLYQDVSSRQSVQDPIGRPIMHYSGIKHATGEAVYCDDMPCVDGELFLY
FVTSTKAHAKIVSLDFSEALAQPGVVDVVTTEDCPGTCKSMFEEGEVLCVGQIICAVLAD
TPARAKKAAAAVKVVYENLEPVILTIQEAIEHNSFFKPQRKLENGNVEEAFKSADQIQEG
EIYIGGQEHFYMETQSIRVLPKGEDKEMDVYVSTQDPTYIQNLIATILNVPSNRITCHVK
RVGGAFGGKTTKTGNIAAITAVAANKYVLFKSHSKVSETRRAVRCVFERGDDMLITGGRH
PFLGKYKVGFMNDGRITAVDVAYFSNAGCTPDDSVLVVEIALMNMDSAYRLPNVRCTGTA
CKTNLPSNTAFRGFGYPQAAFVTETWISEVAIKCRIPPEKVREMNLYKDISQTHFRQEIL
ARTLGMCWNECMEKSSYNSRRLAIENFNKDNYWKKKGLAIIPMKFPIGSLAKFFGQAAAL
VHIYLDGSVLVTHGGIEMGQGVHTKIMQIASRELGIPLSYIHICETNTSSVPNTQVSGGS
LGTDVNGMAVKNACEILMQRLLPIRSKNPKSSWKEWVTEAYMQSVSLSATGFCRSTGEGN
PVHYCVYGVACSEVEIDCLTGDHKNLRTDIVIDFGCSINPAVDIGQIEGAFVQGLGLFTI
EELKFSPNGVLYTRGPAQYKIPSVRDIPEQFNVSLLSNVPNSCAIYSSKGVGEPALFLGS
SIYFAIKDAVLSARRERGMSELFTLNSPATPEKIRMACGDQFTDMIPQNVPGSYVPWAVN
V
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaccctgtagattcacatactctcatattttttgtgaatggacggaagattgtt
gaggaaaatgccgatcctgaagagttgcttctaccctacttaaggaagaaacttcttctc
acgggaacaaaatatggatgtggaggtggtggatgtggtgcttgcacagtaatggtatca
accatccatcctgtttccaagaagattctacatttctcagccaatgcctgcctactgcca
atatgctccatgcatggtgcagccgttacaaccatcgagggcatcggaagcacaactacc
aaattgcatcctgtgcaggagagaatagctaaagctcatggttcccagtgtggtttctgt
actcctgggatggtgatgtctgtgtatagcttactaaggaatcatccagaaccaactatg
gagcagatatatgaaagcctaggaggtaatctctgtcgctgtactggttacaggccaata
gtggatggatgccgaactttctgtaataaaactgattgttgccaagtcaaagagaatggg
atggaaaagatttctacacctgatacagtagataacatcctcacaggtttgtttaaagaa
gaacagtttttacctcttgatccaacacaggaattaatatttccccctgaattactgcta
atggataaagaaaaaaaagaaaaactctttttccaaggggggcgtatgacttggatatca
ccttccagtcttcaggaacttctgcaactgaaagcaacatatccgaaggctccacttgtt
gtgggaaacaccatcgtcggtaggtgtcccgaaatgaagttcagaggaatttttcatcct
gttataatttccccttcaagaataccggagctcaattttgtaattcataaggatgatgga
ataacagtaggggcagcttgcagtttaacagtgctgaaagaagctctaaaggaagttgtc
acccaacaaccagaggaaaagaccaaattatttcatgcccttctacagcaacttgaaaca
ctcggaggtccacagataaggaacacagcatctctaggaggaaacattataagccgttct
ccaacatctgatctaaacccagttctggctgcaggcaactgcattctaactgtggcagca
atagatggaactaggcagatgccattggatgaggcattttttgctcattcgttgaaggct
gaagaggttttagtatcagttcatttaccttattccaagaagggggatcattactccgtt
ttcagacaggcccagagacgagagaatgcattgcctattgtcactgctggaatgaaagtt
cagtttgaagaaaacactgacataattaaagtcattcgtatcttctatggtggtgttggt
ccaaccactgtttttgcaaagaccacatgtcaagatctgataggaaagcactgggatgac
cacatgctaagtgaagcctgcagactcatggtgcatgagattaccctttctccctcagcc
ccgggaggcatggtagaataccgcaggactctgaccatcagcttttttttcaaattctac
cttgaggtgttacagagacttaaccacatgggcactcattattcagatgtcagtgctctt
aacagttttgaaacattatgcaatgaaaatgtccagctgtaccaggatgtatcttcacgt
caatcagtacaagatcccatcggacggcctatcatgcattattctggaataaaacatgct
actggcgaggctgtatactgtgatgacatgccctgtgtagatggcgaactgtttttgtat
tttgtcaccagtacaaaggctcatgcaaaaattgtgtcactggatttctcggaggccttg
gcccagccaggagtggtggatgttgtaacaacagaagattgtccaggcacatgcaaatct
atgtttgaggaaggggaggtgctttgcgtgggtcagatcatctgtgcagttttggctgac
actcctgccagagctaaaaaggcagctgctgcagttaaagtggtgtatgagaatctggag
ccggtcattctaaccattcaggaagccattgaacacaattcattttttaagccacaaaga
aagctggagaatggaaatgtggaagaagcatttaaatctgctgatcaaatacaggaaggt
gaaatatacattggaggacaggagcatttctacatggagacccagagtatccgtgttttg
cctaagggagaggacaaagagatggatgtgtatgtgtctacacaggatccaacatatatt
cagaatcttatagctacaatactgaacgtgccatcaaacaggataacatgccacgtgaaa
agggttggaggagcttttggaggcaaaaccacaaagacaggaaatattgcagcaattact
gctgtagcagcaaacaagtatgtcttatttaaatctcattctaaagtaagcgagacacgg
agggctgttcggtgtgttttcgagcgtggtgatgatatgttaataacaggaggaagacac
ccctttcttgggaaatataaagtgggattcatgaacgacgggcggattacagcagtggat
gtggcttacttcagtaatgcagggtgtaccccggatgactctgttcttgttgttgagatt
gcactgatgaacatggatagtgcttacaggctgcccaatgtgcgatgtacagggactgcc
tgcaagacaaacctcccctcaaacactgccttccgaggatttggctacccacaggctgcc
tttgtcacagaaacttggatcagtgaagtggctataaagtgcagaattccacctgaaaag
gtcagggaaatgaatctgtataaggatatcagccaaacacatttcaggcaggaaatacta
gccaggactctgggaatgtgttggaatgaatgcatggagaagtcttcctacaacagcaga
agactggccattgagaatttcaataaagacaattattggaagaaaaagggccttgccatt
attcctatgaaatttcctattggatcactggcaaagttctttggacaggctgctgctctt
gtccacatctatttggatggatcagtgttggtgacccatggtggaatagagatggggcaa
ggagttcatacaaagattatgcagattgccagtcgtgagttgggcatccctctatcatac
atccatatttgtgagaccaacacaagttctgttccaaacactcaggtctctggaggctcc
ctagggacagatgtcaatggcatggcagtgaagaatgcatgtgaaatccttatgcaacgc
cttctgccaattagaagtaagaaccctaaaagttcctggaaggaatgggtaactgaagcc
tatatgcagtcagtcagcctctcagctacaggattctgcaggtctaccggagagggcaac
ccagttcactactgtgtgtacggagttgcttgctctgaggtagaaattgactgtctcact
ggagatcacaagaacctcaggacagacattgttatagattttggttgcagcatcaaccca
gctgtggatattggacagattgaaggtgcatttgtgcaaggtcttggactatttacgatt
gaagaactcaagttttctccaaacggagtgctctatacccgtggcccagctcaatataag
atcccttctgtccgtgatatccctgaacaatttaatgtgtcactgctttccaatgttccc
aacagctgtgccatatactcttcaaagggagttggagagccagctctgtttttggggtcc
tcaatctattttgctataaaagatgcagtgttatcagcccgaagagaaagagggatgtct
gagctctttacgctaaacagtccagcaactccagagaaaataagaatggcttgtggggac
cagttcacagacatgattccacagaatgtccctggctcttatgtgccctgggctgtcaat
gtgtaa

DBGET integrated database retrieval system