KEGG   Xenopus tropicalis (western clawed frog): 100495429Help
Entry
100495429         CDS       T01011                                 

Definition
aldehyde oxidase-like
Orthology
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:xtr00280]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:xtr00350]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:xtr00380]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:xtr00750]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:xtr00760]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:xtr00830]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:xtr00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1321 aa AA seqDB search
MLNPVDSHTLIFFVNGRKIVEENADPEELLLPYLRKKLLLTGTKYGCGGGGCGACTVMVS
TIHPVSKKILHFSANACLLPICSMHGAAVTTIEGIGSTTTKLHPVQERIAKAHGSQCGFC
TPGMVMSVYSLLRNHPEPTMEQIYESLGGNLCRCTGYRPIVDGCRTFCNKTDCCQVKENG
MEKISTPDTVDNILTGLFKEEQFLPLDPTQELIFPPELLLMDKEKKEKLFFQGGRMTWIS
PSSLQELLQLKATYPKAPLVVGNTIVGRCPEMKFRGIFHPVIISPSRIPELNFVIHKDDG
ITVGAACSLTVLKEALKEVVTQQPEEKTKLFHALLQQLETLGGPQIRNTASLGGNIISRS
PTSDLNPVLAAGNCILTVAAIDGTRQMPLDEAFFAHSLKAEEVLVSVHLPYSKKGDHYSV
FRQAQRRENALPIVTAGMKVQFEENTDIIKVIRIFYGGVGPTTVFAKTTCQDLIGKHWDD
HMLSEACRLMVHEITLSPSAPGGMVEYRRTLTISFFFKFYLEVLQRLNHMGTHYSDVSAL
NSFETLCNENVQLYQDVSSRQSVQDPIGRPIMHYSGIKHATGEAVYCDDMPCVDGELFLY
FVTSTKAHAKIVSLDFSEALAQPGVVDVVTTEDCPGTCKSMFEEGEVLCVGQIICAVLAD
TPARAKKAAAAVKVVYENLEPVILTIQEAIEHNSFFKPQRKLENGNVEEAFKSADQIQEG
EIYIGGQEHFYMETQSIRVLPKGEDKEMDVYVSTQDPTYIQNLIATILNVPSNRITCHVK
RVGGAFGGKTTKTGNIAAITAVAANKYVLFKSHSKVSETRRAVRCVFERGDDMLITGGRH
PFLGKYKVGFMNDGRITAVDVAYFSNAGCTPDDSVLVVEIALMNMDSAYRLPNVRCTGTA
CKTNLPSNTAFRGFGYPQAAFVTETWISEVAIKCRIPPEKVREMNLYKDISQTHFRQEIL
ARTLGMCWNECMEKSSYNSRRLAIENFNKDNYWKKKGLAIIPMKFPIGSLAKFFGQAAAL
VHIYLDGSVLVTHGGIEMGQGVHTKIMQIASRELGIPLSYIHICETNTSSVPNTQVSGGS
LGTDVNGMAVKNACEILMQRLLPIRSKNPKSSWKEWVTEAYMQSVSLSATGFCRSTGEGN
PVHYCVYGVACSEVEIDCLTGDHKNLRTDIVIDFGCSINPAVDIGQIEGAFVQGLGLFTI
EELKFSPNGVLYTRGPAQYKIPSVRDIPEQFNVSLLSNVPNSCAIYSSKGVGEPALFLGS
SIYFAIKDAVLSARRERGMSELFTLNSPATPEKIRMACGDQFTDMIPQNVPGSYVPWAVN
V
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaccctgtagattcacatactctcatattttttgtgaatggacggaagattgtt
gaggaaaatgccgatcctgaagagttgcttctaccctacttaaggaagaaacttcttctc
acgggaacaaaatatggatgtggaggtggtggatgtggtgcttgcacagtaatggtatca
accatccatcctgtttccaagaagattctacatttctcagccaatgcctgcctactgcca
atatgctccatgcatggtgcagccgttacaaccatcgagggcatcggaagcacaactacc
aaattgcatcctgtgcaggagagaatagctaaagctcatggttcccagtgtggtttctgt
actcctgggatggtgatgtctgtgtatagcttactaaggaatcatccagaaccaactatg
gagcagatatatgaaagcctaggaggtaatctctgtcgctgtactggttacaggccaata
gtggatggatgccgaactttctgtaataaaactgattgttgccaagtcaaagagaatggg
atggaaaagatttctacacctgatacagtagataacatcctcacaggtttgtttaaagaa
gaacagtttttacctcttgatccaacacaggaattaatatttccccctgaattactgcta
atggataaagaaaaaaaagaaaaactctttttccaaggggggcgtatgacttggatatca
ccttccagtcttcaggaacttctgcaactgaaagcaacatatccgaaggctccacttgtt
gtgggaaacaccatcgtcggtaggtgtcccgaaatgaagttcagaggaatttttcatcct
gttataatttccccttcaagaataccggagctcaattttgtaattcataaggatgatgga
ataacagtaggggcagcttgcagtttaacagtgctgaaagaagctctaaaggaagttgtc
acccaacaaccagaggaaaagaccaaattatttcatgcccttctacagcaacttgaaaca
ctcggaggtccacagataaggaacacagcatctctaggaggaaacattataagccgttct
ccaacatctgatctaaacccagttctggctgcaggcaactgcattctaactgtggcagca
atagatggaactaggcagatgccattggatgaggcattttttgctcattcgttgaaggct
gaagaggttttagtatcagttcatttaccttattccaagaagggggatcattactccgtt
ttcagacaggcccagagacgagagaatgcattgcctattgtcactgctggaatgaaagtt
cagtttgaagaaaacactgacataattaaagtcattcgtatcttctatggtggtgttggt
ccaaccactgtttttgcaaagaccacatgtcaagatctgataggaaagcactgggatgac
cacatgctaagtgaagcctgcagactcatggtgcatgagattaccctttctccctcagcc
ccgggaggcatggtagaataccgcaggactctgaccatcagcttttttttcaaattctac
cttgaggtgttacagagacttaaccacatgggcactcattattcagatgtcagtgctctt
aacagttttgaaacattatgcaatgaaaatgtccagctgtaccaggatgtatcttcacgt
caatcagtacaagatcccatcggacggcctatcatgcattattctggaataaaacatgct
actggcgaggctgtatactgtgatgacatgccctgtgtagatggcgaactgtttttgtat
tttgtcaccagtacaaaggctcatgcaaaaattgtgtcactggatttctcggaggccttg
gcccagccaggagtggtggatgttgtaacaacagaagattgtccaggcacatgcaaatct
atgtttgaggaaggggaggtgctttgcgtgggtcagatcatctgtgcagttttggctgac
actcctgccagagctaaaaaggcagctgctgcagttaaagtggtgtatgagaatctggag
ccggtcattctaaccattcaggaagccattgaacacaattcattttttaagccacaaaga
aagctggagaatggaaatgtggaagaagcatttaaatctgctgatcaaatacaggaaggt
gaaatatacattggaggacaggagcatttctacatggagacccagagtatccgtgttttg
cctaagggagaggacaaagagatggatgtgtatgtgtctacacaggatccaacatatatt
cagaatcttatagctacaatactgaacgtgccatcaaacaggataacatgccacgtgaaa
agggttggaggagcttttggaggcaaaaccacaaagacaggaaatattgcagcaattact
gctgtagcagcaaacaagtatgtcttatttaaatctcattctaaagtaagcgagacacgg
agggctgttcggtgtgttttcgagcgtggtgatgatatgttaataacaggaggaagacac
ccctttcttgggaaatataaagtgggattcatgaacgacgggcggattacagcagtggat
gtggcttacttcagtaatgcagggtgtaccccggatgactctgttcttgttgttgagatt
gcactgatgaacatggatagtgcttacaggctgcccaatgtgcgatgtacagggactgcc
tgcaagacaaacctcccctcaaacactgccttccgaggatttggctacccacaggctgcc
tttgtcacagaaacttggatcagtgaagtggctataaagtgcagaattccacctgaaaag
gtcagggaaatgaatctgtataaggatatcagccaaacacatttcaggcaggaaatacta
gccaggactctgggaatgtgttggaatgaatgcatggagaagtcttcctacaacagcaga
agactggccattgagaatttcaataaagacaattattggaagaaaaagggccttgccatt
attcctatgaaatttcctattggatcactggcaaagttctttggacaggctgctgctctt
gtccacatctatttggatggatcagtgttggtgacccatggtggaatagagatggggcaa
ggagttcatacaaagattatgcagattgccagtcgtgagttgggcatccctctatcatac
atccatatttgtgagaccaacacaagttctgttccaaacactcaggtctctggaggctcc
ctagggacagatgtcaatggcatggcagtgaagaatgcatgtgaaatccttatgcaacgc
cttctgccaattagaagtaagaaccctaaaagttcctggaaggaatgggtaactgaagcc
tatatgcagtcagtcagcctctcagctacaggattctgcaggtctaccggagagggcaac
ccagttcactactgtgtgtacggagttgcttgctctgaggtagaaattgactgtctcact
ggagatcacaagaacctcaggacagacattgttatagattttggttgcagcatcaaccca
gctgtggatattggacagattgaaggtgcatttgtgcaaggtcttggactatttacgatt
gaagaactcaagttttctccaaacggagtgctctatacccgtggcccagctcaatataag
atcccttctgtccgtgatatccctgaacaatttaatgtgtcactgctttccaatgttccc
aacagctgtgccatatactcttcaaagggagttggagagccagctctgtttttggggtcc
tcaatctattttgctataaaagatgcagtgttatcagcccgaagagaaagagggatgtct
gagctctttacgctaaacagtccagcaactccagagaaaataagaatggcttgtggggac
cagttcacagacatgattccacagaatgtccctggctcttatgtgccctgggctgtcaat
gtgtaa

DBGET integrated database retrieval system