KEGG   Xenopus tropicalis (western clawed frog): 100495530Help
Entry
100495530         CDS       T01011                                 

Gene name
plce1
Definition
(RefSeq) phospholipase C epsilon 1
  KO
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100495530 (plce1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100495530 (plce1)
   04070 Phosphatidylinositol signaling system
    100495530 (plce1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100495530 (plce1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100495530 (plce1)
Membrane trafficking [BR:xtr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100495530 (plce1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100495530 (plce1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
7
AA seq 1780 aa AA seqDB search
MTKDNIFSIEKCPKPPQPSVNTPKSSESEKSHTRLEVSSWVTWLILTAGSMEEKREVFSH
VVHIAKCCWNMGNYNAVMEFLAGLRTRKVLKMWQFMDQSDIETMRSLKDAMAQHESSSEY
RKVVNRALNIPGCKVVPFCGVFLKELCEVLDGAASIISLCPQYDAQSETLEFVSDYNGQD
NFLQRIGKDGLKNTEKESTVNSIMQTIRSCNRSLESEEGEDNLSDAGGIRKSTVMDRTRF
QFIMGDLSDSESDIFEQSKEWDLHRREEQQKAFSHGTELIPWYVLSMRADVYQFLQQGVT
VIRYDQETHISVRCFLQLQPDNSTLTWTKPTTTCLANTKNKLGTVSSSAEIKFQFLANAG
MNGLAEGFLDLFSVKAVYMGHPGIDMHTVCVQNKLCNMNLEENGVTLLYGLHTTDNKLLH
FVAPKYTARTLYDGLLELTKAVRKIKRFPDQRLQWLRKQYVSLYQEENRFEGPALAQAIE
LFGGRRWSTRNTSTGTLTKSTEKPNVQRNNTLGINTAKKKKKVLMRGESGDAADDEMATR
KTKSCKESRSRSGSDPPEIDEQEEQDLNIIAGYSPSQMLPSRRAHSMSTSGSPNLTPGPS
IPLRPASSPILSNSNKPQSNTWSSSSWHGRVKGGMKGFQSFMVSDSNMNFTEFVELFKSF
SVRSRKDLKDIFDVYAVACNRSGAESVPLYTNLTIDENVVGVQPDLDLLTRNVSDLGLFI
RSRQQLSENQRQISDAIAAASIVTNGTGVESTSLGIFGMGILQFNDFLVNCQGEHYTYDE
VLSIIQKFEPSISMRQQGLMSFEGFARFLMDKDNFASRNDESQVNTEELQLPLSYYFIES
SHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGMPIIYHGHTLTTKIPFKDV
IEAIGRSAFITSEMPIVLSIENHCSLPQQRKMADIFKNVFGEKLVTKFLFESDFSDDPML
PSPWQLRNKVLLKNKKLKAHQTPVDILKQKAHQLASMQAQASNGSQMVSPSTNNEEEEDE
EDEYDYDYESLSDADVLNASPAPNSQEDNILDDRSETKTNSDKLQFEYNEEASKRIKKTD
GSSINTKGKVYDMELGEEFYLPQNKKESRQIAPELSDLIIYCQAVKFPGLTTLNPCGSGR
GKERKSRKSIFGNNPGRTSPGEPTALAKTSGKGTNETRQSWEEPCSPPFNPSTSLSAIIR
TPRCYHISSLNENAAKRLCRRYSQKLIQHTAYQLLRTYPAATRIDSSNPHPLIFWLHGVQ
LVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVQWDRTCPMYQLFSPLERDLENMEPAI
YSLTIVSGQNVCPGNSSGSPCIEIDVLGMPVDSCHFRTKPIHRNTLNPMWNEQFLFRIYF
EDLVFLRFAVVENNSSAVTAQRIINLKALKRGNRHLQLRNLHNEPLEVSTLFINSRRMEE
IPNGNTLPASLFFSSEERKTPATFKATVHGIPGPEPFTVFEISLGTTAKQLLDHILATIQ
GNEADITDYFLMEEKCFISKDKNECKKLPFQRVISPEEDILQILNSWFPEEGYVGRIVLK
TREENMNDKNVQEDKEEKEVTVSSDEETFFVQVHDVSPEQPRTVIKALRFSTAQEVIQQA
LCKAKYSYSILSNPNPSDYVLLEEVIKEASNKKSSTSKTIQRVLLDQECVFQAQSKWKGA
GKFILKLKEQVQAARDDKRKGLSIASELKKLAKSSRQSRNFTLSPQIFLSEDACESPEPT
KSKTQEKPSADNEVNVHPTCCRRSSAAWYFLLLKNWKLPK
NT seq 5343 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaggacaatattttttctatagaaaagtgccccaagccaccccagcccagtgtc
aacaccccaaaatcttcagaatctgagaagagtcacactaggctggaggttagctcctgg
gtcacatggctgattctaacggcaggatctatggaggagaaacgagaagttttctcacac
gtcgttcacattgcaaagtgttgctggaacatgggcaattacaacgctgtcatggaattc
ctggcaggcctcaggacaagaaaagttctaaaaatgtggcaatttatggatcagtccgac
attgaaacgatgcgcagcttgaaagatgcaatggcacagcatgaatcctcatccgagtac
aggaaagtggtgaacagggccctaaatatacctggctgtaaggtggttcctttttgtggg
gtctttctaaaggaactctgtgaagtccttgatggagcagcgagtatcatcagtctgtgt
cctcagtacgatgctcagagtgaaacactggagtttgtttcagattacaatgggcaagac
aactttctccagcgaatagggaaagatggattaaagaacacagagaaagagtccactgtg
aatagtatcatgcagacaattcgtagctgtaaccgtagcttggaatctgaagaaggagaa
gacaatctcagcgatgccgggggtatcaggaaaagcacagtgatggacagaactagattt
cagtttattatgggagatttatctgactctgaaagtgatatctttgaacaatcaaaagag
tgggacttgcataggagggaagagcaacagaaggcattcagccatggaacagagctaatt
ccctggtatgtgttatccatgagagcagatgtctatcagtttcttcagcaaggagtgact
gtcatccgctatgaccaggagacacacatttctgttcgttgtttccttcaactccaacca
gacaactccacattgacttggacaaaaccaaccacaacgtgtcttgcaaacactaaaaat
aaattaggaactgtaagtagcagtgcggagattaaatttcagttccttgccaatgctgga
atgaatggactggccgaaggattcttggacttattctctgtaaaggcagtttacatggga
catccgggaattgatatgcacactgtgtgtgttcaaaacaaactatgtaatatgaacctg
gaagaaaatggtgtcacattgctttatgggctgcacactactgacaacaagttgctgcac
tttgtagctccgaaatacacagccaggacattgtatgatggactcctggagttaaccaaa
gcagtaaggaagataaaacgctttcctgatcagagattacagtggttaaggaagcagtat
gttagtctctaccaggaggaaaacagatttgaaggaccagctttggcacaagctattgag
ctgtttggagggcgacgctggagtacgagaaacacgagcacagggaccttaaccaaaagc
acagagaaaccaaacgtgcagaggaataacactctcggcatcaacactgccaagaagaag
aagaaagtgcttatgaggggcgagagtggggatgcagccgatgatgagatggcaacccgc
aaaacaaaaagctgcaaggaaagtcgcagtagaagtggctctgatcctccagaaatcgat
gagcaggaagagcaagatctgaatattattgctggatattcaccatctcaaatgctccca
tcccgaagagctcattctatgtcgacttctggttctcccaacttgacacccgggccatct
attccactgcgacctgcctcctctcctattttgtccaactcaaacaaaccccagtccaat
acgtggagcagttcaagttggcatggaagagttaaaggtgggatgaaaggcttccaatca
ttcatggtttcggacagcaacatgaactttactgaatttgtagagcttttcaaatctttt
agcgtaagaagtcggaaagacctgaaggacatttttgatgtgtatgctgtggcctgcaat
cggtcaggtgcagaatcagtccctctctacactaatttgacaattgatgagaatgtagtt
ggagtccaacctgatttagatttattgaccaggaatgtgtccgacttgggtttattcatt
cgcagcagacagcaactgtctgagaaccaaaggcaaatctcagatgccattgcagctgcc
agcattgtaactaatggaactggagtagaaagcacatccctgggcatatttggaatggga
atactgcagtttaatgatttcctggtgaattgccagggtgaacattacacctatgatgaa
gttcttagcattattcagaaatttgaaccaagtatcagtatgcgccagcaggggctgatg
tcatttgaaggatttgcaaggttcctgatggataaagacaattttgcatcaagaaatgat
gagtctcaggtaaacacagaagaacttcagctgcccctttcctactatttcattgagtct
tcacacaacacctaccttacagggcaccagctaaaaggagagtcttcagttgagctgtac
agccaggtccttttgcaggggtgccgaagtgttgaattagactgctgggatggagatgac
ggcatgcctatcatttatcatggacatacactaactactaaaattccctttaaggatgtc
attgaagctattggccgaagtgcatttattacctctgaaatgccaatcgtactgtccata
gaaaaccattgctccctaccacagcagcgtaaaatggcagatatatttaagaatgtcttt
ggtgaaaaactggtgacaaagttcctgtttgaaagtgacttttcagatgatccgatgttg
ccttctccatggcaattgagaaataaagtgcttctgaaaaataaaaagctgaaggcacat
caaaccccggtggatatactgaagcagaaggcacatcagctggctagcatgcaagcacaa
gcaagcaatggtagccaaatggtaagccctagcacaaacaatgaagaagaagaagatgaa
gaagatgaatatgattatgactatgagtctctgtcagatgccgatgtccttaatgcttcc
cctgctcctaacagccaggaagataatattcttgatgaccgatctgaaactaaaaccaac
agcgacaaactgcaatttgaatataatgaggaagcttcaaagcgaatcaaaaagacagat
ggcagcagtattaacactaaaggaaaggtctatgacatggagttgggtgaggaattctat
cttccacaaaacaaaaaagagagcaggcaaattgcacctgaattgtcagaccttattatc
tattgccaagctgtcaaattcccaggccttacaacattaaacccatgtggatctggcaga
gggaaggaaagaaaaagcaggaagtccatttttggcaacaaccctggcagaacaagtcct
ggggaaccaacagcacttgccaaaacatctggaaaaggtacaaatgaaacacggcagagc
tgggaagagccatgttctcctccctttaaccccagcacttccctcagtgcaataatcagg
acacccaggtgctaccatatctcttccctaaatgagaacgcagccaagcgcttgtgccga
aggtattctcagaaactcattcaacataccgcatatcaactgctccgaacatatcccgcc
gccactcggatagactcttccaacccacatcctcttattttctggcttcatggtgtacag
ttggttgctctaaactaccaaactgatgatctccccttacatctaaacgccgccatgttt
gaagcaaatggtggttgcggatatgtgttaaagccccccgtgcagtgggataggacctgc
ccaatgtaccaattattctcaccattagaacgagatttagaaaatatggaaccagcaata
tattctttgacgatagtctctgggcaaaatgtgtgtccaggtaacagctcaggcagcccc
tgcattgaaattgatgtcttgggtatgccagtagacagctgccattttcggaccaaacca
atccatcgcaataccttaaatcccatgtggaatgaacaattcttattccgaatatacttt
gaggatcttgtgtttcttcggtttgctgtggtggaaaacaacagttctgctgtaactgcc
caaagaataattaatcttaaagctttaaagagaggtaacagacaccttcagctaagaaat
ttacataatgagcccttagaggtttctaccttatttataaatagcaggagaatggaagaa
atccctaatggaaataccttacccgcctccttgtttttcagctcagaagaaagaaagact
ccagccacatttaaagctacagtacatgggattcctgggccagaaccatttacagtgttt
gaaatcagtcttgggacaactgcaaagcaacttcttgatcatattttggctactatacaa
ggcaatgaagcagacatcactgactattttttgatggaggaaaaatgctttatatctaaa
gacaaaaatgaatgcaagaaattgccgttccagagagtgattagcccagaagaggatatc
ctgcaaattttgaatagctggttcccagaagaaggctacgtggggagaattgttcttaaa
acacgagaggagaacatgaatgacaaaaatgttcaagaggacaaagaagaaaaagaggtg
accgtgagctccgatgaggagactttctttgtccaggtccatgatgtttctcctgaacag
ccaagaacggttatcaaagctttacgattcagtacagcgcaggaagttatccagcaggct
ttatgcaaggctaaatactcatacagcatcctgagcaaccctaatcctagtgattatgtg
cttctggaggaagtcatcaaagaagcttcaaataagaagtcttctacctccaaaacaatt
cagagggttctcttggatcaagagtgtgtattccaggcacagagcaagtggaagggagca
gggaaattcattcttaaactgaaggaacaagtccaggcggcaagagacgacaagcgcaaa
ggtctgtctatagccagtgaactgaagaagctagcaaagtccagccggcaatctcggaac
ttcactttgtcacctcagatatttttatcagaagatgcctgtgaaagccctgaacctaca
aaaagcaaaacgcaggaaaagccttcggcagataatgaagtaaatgtgcatccaacctgc
tgcaggaggtcttctgctgcctggtactttctgttgctgaagaactggaagctgccaaaa
tga

DBGET integrated database retrieval system