KEGG   Xenopus tropicalis (western clawed frog): 100495647Help
Entry
100495647         CDS       T01011                                 

Gene name
bdh1
Definition
3-hydroxybutyrate dehydrogenase, type 1
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:xtr00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:xtr00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 337 aa AA seqDB search
MLCAGTVMASCHLPVRACANHFRFMPKWSFPLQSAVGKRPFASHTAEDSKAVLVTGCDSG
FGFSLAKHLHNKGFIVYAGCLFKDKGEAGVKELDSMKSDRMRTIQLNVVKQDEVDRTVEI
IRENLTNPEKGLWGVVNNAGISTFGEVEFTSMETYKEVAEVNLWGTVRVTKACLPLIRRA
KGRVVNISSMLGRMANPARSPYCITKFGVEAFSDCLRYEMHPLGVKVSVVEPGNFIAGTS
LYSPEKIKAIGDKMWADLPEVIKNDYGKKYFDEKIATMNTYCNSGSTDTSEVIDAITHAL
TASTPYTRYHPMDYYWWLRMQIMTHMPGAISDKIYIH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcgcagggacagttatggcaagctgccatctcccagtgagagcatgtgcaaac
catttcaggtttatgccgaaatggtcctttcctctccaatcagcagttggaaaacgtccc
tttgcaagccacacagctgaggatagtaaagctgtacttgtcacaggatgcgattctgga
tttggattttctttggccaagcatctgcacaacaaaggattcatcgtttatgcaggatgt
ctgtttaaggacaaaggggaagccggggtgaaggagctggacagtatgaagagtgacaga
atgaggacaattcagctaaatgttgtaaagcaggatgaagtggataggactgtagaaatc
ataagggaaaatcttacgaatcctgaaaagggtttgtggggtgttgttaacaatgctgga
atctctacatttggagaagtggaatttaccagcatggagacatacaaagaggttgctgag
gttaacctgtggggtacagtccgtgttaccaaagcttgtctccctcttattcgaagggcc
aaaggccgtgttgtgaatatcagcagtatgttgggtcgtatggccaacccagctcgctcc
ccctattgcatcaccaaatttggtgtagaagctttctctgactgccttcgctatgagatg
catccccttggagtaaaggtcagtgtggtggagccagggaattttattgctggcaccagc
ctatacagcccagagaaaattaaggctattggtgacaagatgtgggcggaccttcctgaa
gtcataaagaatgattatggcaaaaagtattttgatgaaaaaatagccacaatgaacact
tactgcaatagtggatcaacagatacctctgaagttattgatgctatcactcatgccctt
actgcttccacaccctacacacggtatcaccccatggattactattggtggcttcgaatg
cagatcatgacacacatgcctggtgccatatctgacaagatttacattcattag

DBGET integrated database retrieval system