KEGG   Xenopus tropicalis (western clawed frog): 100495654Help
Entry
100495654         CDS       T01011                                 

Gene name
acaca
Definition
(RefSeq) acetyl-CoA carboxylase alpha
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100495654 (acaca)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    100495654 (acaca)
   00640 Propanoate metabolism
    100495654 (acaca)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    100495654 (acaca)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    100495654 (acaca)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100495654 (acaca)
Enzymes [BR:xtr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     100495654 (acaca)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     100495654 (acaca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Xenbase: 
Position
2
AA seq 2324 aa AA seqDB search
MEESLPQSKLLDQHSRFIIGSVSEDNSEDEFSSMVRVDLEDKERSSSPASIASTASDTLS
DMGLSNYQDNLALQMRPSMSGLHLVKQGRDRKKIDLQRDFTVASPAEFVTRFGGNKVIEK
VLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPG
GPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWSGSGLKVDWQESDLKKSTLIVPPEVYGKGYVKDVDDGLKA
AEVVGYPVMIKASEGGGGKGIRKVNNAEDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEV
QILSDQYGNAISLFGRDCSVQRRHQKIIEEAPASIATATIFEQMEQCAVKLAKMVGYVSA
GTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGVPLHRIKDIRMLY
GLPAWGDSPIDFDNSLNAPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLET
ESFQNNRIDTGWLDRLISEKVQAERPDAMLGVVCGALHVADVTFRNSVSNFLHSLERGQV
LPAHTLLNTVDVELIYEGEKYVLKVTRQSPNSYVVIMNNSCVEVDVHRLSDGGLLLSYDG
SSYTTYMKEEVDRYRITIGNKTCVFEKENDPSILRSPSAGKLIQYVVEDGGHVFAGQCYA
EIEVMKMVMTLTAVESGCIHYVKRPGAALEPGCVIAKLQLDDPSRVQQAELHRGPLPLIH
STALRGEKLHRVFHCVLDNLVNVMNGYCLPEPYFSSKLKDWVERLMKTLRDPSLPLLELQ
DIMTSVSGRIPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSDREV
FFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLKVETQFQHGHYDKCVFALREENKSD
LTMVLNSIFSHAQVTKKNLLITMLIDQLCGRDPTLTDELLNILMELTQLSKTTNAKVALR
ARQVLIASHLPSYELRHNQVESIFLSAIDMYGHQFCIENLQKLILSETSIFDVLPNFFYH
SNQVVRMAALEVYVRRAYIAYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRMSFSSNLNH
YGMVHVVSDVLLDTSFTPPCQRMGGMVAFRTFEDFVRLFDDVMSCFSDSPPQSPVFPEAG
HPSLYDEDDNKSSRDEPIHILNVAIKTDCDIDDDGLAAMFREFTQSKKAVLMDHGIRRLT
FLVAQKREFPKFFTFRARNKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHL
YLGAAKVEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEVAFNN
TNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVLQAELKINIRLTPTG
KQIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQAYGDKQGPLHGMLINTPYVTKDLL
QSKRFQAQSLGTTYVYDIPEMFRQALIKLWESMEAHAFLPKSPLPSDVLTYTELVLDDQG
QLVHMNRLPGGNEIGMVAWKMTLKSPEYPDGRDIIVIGNDITYKIGSFGPQEDLLYLRAS
ELSRSEGIPRIYVAANSGARIGLAEEIRHMFHVAWEDPADPYKGFKYLYLTPQDYKKVSA
LNSVHCEHVEDEGESRYKITDIIGKEEGLGVENLRGSGMIAGESSLAYEEIITINLVTCR
AIGIGAYLVRLGQRTIQVENSHIILTGAGALNKVLGREVYTSNNQLGGIQIMHNNGVTHS
TVYDDFEGVYTILQWLSYMPKCVASPVPILTPKDSIERLIEFTHTKAPYDPRWMLAGRPH
PTQKGQWLSGFFDYGSFMEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSVPADPAN
LDSEAKIIQQAGQVWFPDSAFKTAQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQVLKF
GAYIVDGLREYRQPVLVYIPPQAELRGGSWVVIDPTINPRHMEMYADKESRGGVLEPEGT
VEIKFRRKDLIKTMRRVDPVYIHLAEKLGTPELGAADCKELETKLKEREEFLLPIYHQVA
VQFADLHDTPGRMQEKGVITDVIEWKTSRTFFYWRLRRLLLENVAKKKIHSANPELTDGQ
IQAMLRRWFVEVEGTVKAYLWDNNKDVVEWLEKQMAEEEGTRSVVDENIKYISRDYILKQ
IRSLVQENPEVAMDSIVHMTQHISPTQRAEIVRILSTMDSPTSS
NT seq 6975 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtctttgcctcagtctaagttgctcgatcagcattcccgtttcatcattggc
tcggtgtcagaggacaattccgaggatgaatttagctcaatggttagagtggacctagag
gataaagagagatcttcatctccagcatccatagcctccacagcctcagataccctttct
gatatggggctctcaaactatcaggacaaccttgctctgcaaatgaggcccagcatgtca
ggtttgcacttggtcaaacaaggtcgggatagaaagaagattgacttgcaaagggatttt
acggttgcctctccagcagaatttgtcactcgttttgggggaaataaagttattgaaaag
gtactaattgccaataatggcattgcagcagtaaaatgcatgcgttcgattagacggtgg
tcctatgagatgttccgaaacgagagagccatccggtttgttgttatggttaccccagaa
gatctaaaagccaatgcagaatatatcaaaatggcagatcattatgtacctgtacctggt
ggaccaaacaacaacaattatgcaaatgttgaactcatccttgatattgcaaaaaggatt
ccagtccaggctgtgtgggctggatggggccatgcatcagaaaatcccaaactaccagaa
ctcctgctcaaaaatggaatagcttttatgggccctcccagtcaagccatgtgggcatta
ggagacaagattgcatcttccattgttgcccaaacagctggaattccaacgctcccatgg
agtggcagtggattaaaagtagattggcaggagagtgatctaaagaagagcactttaatt
gtacctccggaagtatatggaaaaggatatgtgaaagatgttgacgacggtttgaaggca
gcggaagtcgttggatatcctgtcatgattaaggcttctgaaggtggtggaggcaaagga
atcaggaaagtgaacaatgcagaagattttcccaacctcttccgccaggttcaggcagaa
gttcctggctcccctatatttgtaatgagactggccaagcagtcacgtcatcttgaggta
cagattctctctgatcagtatggaaatgccatctcactttttggccgtgactgctctgta
cagcgacgccaccagaaaattattgaagaggcacctgcatcaattgctactgccacaatt
tttgagcagatggagcagtgtgctgtgaaacttgcaaaaatggttgggtatgtgagtgct
ggcactgtggaatatctttatagccaggatggtagcttttacttcttagagttaaaccca
cggctccaagtggagcatccctgcactgagatggtagctgatgtcaacctaccagcagca
caattgcagattgcgatgggggtaccactccatagaattaaggatatacgaatgctgtat
ggactccctgcttggggggattcacccattgattttgacaattcactaaatgccccatgc
cctagaggtcatgtcattgctgctcgtattaccagtgagaatccagatgagggatttaag
ccaagctcaggaactgttcaagaactcaatttccgcagcaacaaaaatgtctggggctat
tttagtgtggcagcagcaggtggtcttcatgaatttgcggattcacagtttggtcattgt
ttctcatggggagaaaaccgagaggaagccatctcaaatatggtggtagctttaaaagaa
ttgtcgatacgaggcgattttcgaactacagtagagtatctgataaaacttttggagacc
gaaagttttcagaacaatcgcattgatactggctggctggataggctgatctctgagaaa
gtacaggctgaacgcccagatgccatgcttggagtcgtttgtggagccttgcatgtagca
gatgttaccttccgcaacagtgtctccaattttcttcactcacttgagagagggcaggtt
ctgccagcacatacactgctgaacacagtagatgtggaactcatctacgaaggagagaaa
tatgttctaaaggtgacacgtcaatctcctaattcgtatgtggtgataatgaataactcc
tgtgtagaagtagatgttcacaggctgagcgatggtggccttcttttgtcctatgatggc
agcagctataccacttatatgaaagaagaagtcgacaggtaccgcataactattgggaat
aaaacatgtgtctttgagaaagagaatgatccctcaatcctgcgctcaccatctgctggc
aagttaattcagtatgtggtggaggatggtggccatgtgtttgctggtcagtgctatgct
gaaatagaggtaatgaagatggtgatgacactgacagcagtggaatcagggtgtatacac
tacgtaaaaagacctggggcagccctggaaccaggatgtgtgatagctaagcttcagctt
gatgaccccagccgtgtacaacaggctgaacttcataggggaccccttcctctgattcac
agcacagcccttcgaggagagaaacttcatcgggtgtttcactgtgttctagataacctg
gtcaatgtgatgaatggatattgtcttccagaaccctactttagcagcaagttaaaagac
tgggttgaaagactgatgaagaccctaagagacccatccttacctctgttggagcttcag
gacatcatgaccagtgtgtctggtcgcattcctccaaatgtagaaaaatcaatcaaaaag
gaaatggcccaatatgccagtaacattacttctgtgttgtgccagtttcccagccaacag
attgctaatatactagacagccatgctgcaacccttaatcgtaaatctgaccgagaggtt
ttcttcatgaacacacagagtatagtgcagctggttcaaaggtaccgaagtggtataagg
gggcatatgaaagcagtagttatggatctgctgcgtcagtatttgaaggtggagacacag
ttccaacatggtcactatgataagtgtgtctttgctctccgtgaagagaacaaaagtgac
ctgacaatggtgctgaattctatattttctcatgcgcaagtcaccaagaagaatctgtta
atcaccatgctcattgaccagttgtgtggccgagatcccacattaacagatgagttgttg
aacatacttatggaacttacccagctaagcaaaacaacaaatgctaaagttgcactgcgg
gcccggcaggtcctcatcgcttcacatttgccttcttatgaacttcggcataaccaagtg
gaatctatatttttgtctgccattgacatgtatgggcaccagttttgcattgagaatttg
cagaaactcattctatcagagacctccatatttgacgttctaccaaacttcttttaccat
agtaaccaggtggtgaggatggcagcattggaggtatatgttcggagggcttacattgcc
tatgaactcaacagtgttcaacaccggcagcttaaggacaacacgtgtgtggttgagttc
cagtttatgttgccaacatcgcacccaaacagaatgtctttctcttcgaaccttaaccac
tatggaatggttcatgtcgtcagtgatgtactattggatacttcatttactccaccctgc
caaaggatggggggcatggttgcctttcggacatttgaagattttgtgagattatttgac
gatgtgatgagttgcttctcagattctccccctcaaagtcctgtatttcctgaagctggt
catccttcgctttatgacgaagatgataataagagctccagagatgaacctattcacatc
ctgaatgttgccattaaaacagattgtgatattgatgatgatggactggcagccatgttt
cgggaatttacacagagcaaaaaagctgtgttaatggatcatggtattcgtcggctgaca
tttctggtagcacaaaagagagaatttcccaagttttttactttccgtgcaagaaataag
tttgaagaagacagaatctacaggcatttggaacctgctcttgcctttcaactggagctg
aatcgaatgcggaatttcgatctgacagcaataccatgtgcaaatcacaaaatgcatttg
tatctgggagccgcaaaggttgaagtaggcactgaagtaactgattaccgtttctttgtc
cgggctatcatcaggcactctgacttggttacaaaggaagcctcatttgagtacctgcag
aatgaaggggagagattgcttcttgaagcaatggatgagctggaggtggcttttaataac
actaatgtacgcactgactgcaatcacatctttcttaactttgtacctactgttattatg
gacccctcaaagattgaagagtctgttcgtagtatggtgatgcgctatggaagtcgtttg
tggaaactccgtgtcttacaagctgaactgaagattaatatccgcctgacacccacaggg
aagcagataccaatacgactctttttaaccaatgaatctggctactacttggacatcagt
ctttacaaagaggtgactgactcaaggactgctcaaatcatgttccaagcgtatggtgac
aaacaaggtccacttcatggcatgctaattaatactccttatgtgacaaaagatctattg
cagtccaaaaggtttcaggcacagtctttgggaacaacctatgtttatgatattccagaa
atgtttcgacaggcacttattaaactatgggaatctatggaagctcatgcatttctgccc
aagagccctttgccttcagatgttctcacttatacagaactggtactggatgaccaaggg
cagttagtacatatgaataggcttcctggtggaaatgagattggtatggtggcttggaaa
atgaccctcaagagtccagagtatccagatggccgtgacatcatagttattggaaatgac
atcacttataagattggctcatttggtccacaagaggatcttttatacttaagagcatca
gaactctctcgatcggaggggattcctagaatatatgttgcggcaaacagtggtgcaaga
ataggactagcagaagagatccgccatatgtttcatgtcgcatgggaagaccccgctgac
ccttataaaggttttaaatacttatatttgacaccccaagattacaagaaggtgagcgct
ctgaattctgtacactgtgaacatgtggaggatgaaggtgaatccagatataagataaca
gacattattggcaaagaagaaggccttggagtggaaaacctcagaggatctggcatgatt
gctggggagtcctctttagcctatgaagaaatcatcaccatcaatctggtcacatgtcgt
gcaattggcattggagcctatttagttcgactgggtcaacgaacaatccaggtagaaaat
tcacatatcatcctgacaggagcaggggctcttaacaaagtccttggccgagaggtatac
acatcaaacaaccagctgggtggcatccagataatgcacaacaatggagtaacacatagc
actgtgtatgatgattttgaaggggtgtacacaattttgcagtggctttcttatatgccc
aagtgtgtagccagtcctgttcctattctgacaccaaaggattctattgaaagacttata
gaattcactcacaccaaagctccttatgatccacgatggatgctggcaggacgcccccac
cccactcagaaagggcagtggctgagtggcttctttgactatggttctttcatggagatc
atgcagccatgggcacaaactgtagttgttggaagggctaggttaggaggcatacctgta
ggagtggttgccgtggaaacaagaactgtagagttaagtgtacctgctgatcctgcaaac
ctggactcagaagccaagataatccagcaagctggccaagtttggttcccagattctgcc
tttaaaactgctcaagccatcaaggatttcaacagggaaggtcttccccttatggtgttt
gcaaactggagagggttttctggtggaatgaaagatatgtatgaccaagtgctgaagttt
ggggcctacattgtggatggtttgcgtgaataccgccagccagtgttggtatacattcca
cctcaggctgaactcagaggaggctcatgggtagtaattgatcccacaataaacccaagg
cacatggaaatgtatgctgacaaggaaagcaggggaggtgtcttggagccagaaggaaca
gtagaaatcaaatttaggagaaaggatttgattaagactatgcgtcgtgttgacccagtc
tacattcacttggcagagaaattaggcacaccagaattaggtgctgctgactgtaaagaa
cttgagaccaagctgaaggagcgggaggagtttctgctacctatctaccaccaagtggct
gtgcagtttgcagacttgcatgacaccccaggcagaatgcaggaaaagggagttattaca
gatgttattgagtggaagacgtcacgcacatttttctactggagactaaggaggctgctt
ttggaaaatgtagcaaaaaagaagattcacagtgcaaatcctgaacttacagacggtcag
atacaagctatgcttaggcgatggttcgtggaagtagaaggaactgtaaaggcctacctg
tgggacaataataaggatgtggttgagtggctggagaagcagatggcagaagaggaaggt
actcgttctgtggtcgatgaaaacatcaagtacatctccagagattatatccttaaacaa
atccgcagcttggtgcaagaaaaccctgaagtcgctatggattccattgtgcatatgact
caacatatttcgcccacccaaagagctgaaattgtacgcattttatcaactatggattcc
ccaacttcctcctaa

DBGET integrated database retrieval system