KEGG   Xenopus tropicalis (western clawed frog): 100495970Help
Entry
100495970         CDS       T01011                                 

Gene name
pfn4
Definition
profilin family, member 4
Orthology
K05759  
profilin
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100495970 (pfn4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100495970 (pfn4)
Exosome [BR:xtr04147]
 Exosomal proteins
  Proteins found in most exosomes
   100495970 (pfn4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 128 aa AA seqDB search
MNQIQNLLYDSLIKTQHVEAAALIRIKEGAVFPSPPRFQVQPQIMKTIVDAFKNPSALRK
EGLQLWDKSYHCVRADKNSIYAKCDDGGLVLVKTKSNILLATYRDGMYPSVCVEAAETLG
SYFREKEI
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagatacagaatttgctttacgactccttgataaagacgcagcacgtggaggcc
gcagcgctcataaggataaaagagggggctgtgttcccttcacccccacgcttccaggta
caaccgcagataatgaaaactatagtagatgcctttaagaacccatctgcactaaggaaa
gaagggcttcagttatgggacaagagctaccactgtgtgcgggctgataaaaattccatc
tatgcaaaatgtgatgacgggggacttgtgttggtaaagacaaagtcaaatatcctgctt
gcaacttaccgggatggcatgtaccccagtgtgtgcgtggaggccgctgagacattaggt
tcttatttcagagagaaagaaatctga

DBGET integrated database retrieval system