KEGG   Xenopus tropicalis (western clawed frog): 100496520Help
Entry
100496520         CDS       T01011                                 

Gene name
kat6a
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1883 aa AA seqDB search
MVKLANPLYTQWILEAIRKVKKQKQRPSEERLCNAVSTSHGLDRHTVLEQLELSVKDGTV
LKVTNKGQNSYKDPDNPGRLALPKATKNQGRPEGLDWHRLLKRALESLEEPGGSSLKSIE
RFLRSQRDVSASFGGNTGASSAFHQQLRLAVKRALAHGRINKEGSLYQLNAKLAEGKQGW
ESLASLPPVCLLPHEKDKPVAEPIPICSFCLGTKESNREKKPEELISCADCGNSGHPSCL
KFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCEPPLTRMPK
GMWICQICRPRKKGRKLLHKKAAQIRRRYTNPIGRPKNRLKKQSSTTNPSFGKGRGAPGR
GRKRKLSMCSTSSDDDRSSDDHRGCGTSVPFNKKTKGLIDGLTKFFTPSPDGRKARAEAL
DYSLQRSRKRGPRKSGQADWDNQEGWDCKLDGEDHPGMISEKEIALFQDIQEQALQVKTP
PPKCGLLYVSILCRLPKLYLCEFCLRYMKSRTMLQQHTKKCNWFHPPANEIYRKDNLSVF
EVDGKVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDSKGCHLVGYFSKEKHCQ
QKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVV
LECLHHNREHQLSIKRLTKLTGICPQDIAATLHQLRMLELRGDRVVLVRREQQIQTHMSR
LQARPREVEVDPEALRWTPVIVTNSVVSDEEEAESEEEEDEEEEEDEEQRSPLKDNSQQV
LRSISREFERETCPVLEKEKSPPTLRPSSPNSRFPNPRQLQDLLRDSLPANSQPPGRGRR
GRRGRRGRGFGSSSRAADLLRLLAREPPGPPRRNGERGRSGSRRGRLKRLADPMLRRDFL
EQQERLAQRFESEHPQLRRFSESSEEEDEDEEEENHSLRSDSPPILTKPTLKRKKPGAHR
RRRVRRRKHHHNSSVVTETISETTQVLDEPFDDSDSERQMPRLEPEEEGSGRDTPFSPSY
FPYLTPYPLLRHNRPLGKSRSNTEQAQGSAVQPTVSSMRSTEGSASLPDSCNPAPVKKKG
WPKGKSRKPLHWKKRPGRKPGFKLNREPPPPVPTSPPPARPGRKSRTREEEEEEEEEEEE
PTREESPERKEPEKEIVETVTEKAAEEEPTNTVVQPSSPSESSSCSESSSREVENHPASP
EMPVQTGEEPQAVTEEAEQEEEERTPEEKPETTTVSNQQEDQDADDEDEGAKEAEEGEEL
EPELVPEEPAPQEPCVVSSSEEDDKGDGAQEATEGPDPPSCLEEAEECQEKVEEEQKEEE
EEAEEVIPHTELDLETVQAVQSLTQEESSERDDGTYGDCEDETLTACQTLQSFTQAEEDP
QLSLSEECHPSAHDSPISSVHSHPSQSVRSASSPSVPQTMENNGTGVYPQISPDAGSLSA
PSIQNLETTSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSSMGGGSISS
QSSCSYASNSNANGGGGLPSTASMAQNGCAVNQQMASMASMLQPSQACSIKSPQSCASER
PPSSSNNNQPPPPPPPPPPLPPQQPQPPPQQQQPPMSQCSMNNSFGPSPMIMEIPDQSNG
SNLSIYPGDFGAGGYTQPSATFSLAKLQQLTNTIMDPHAMPYSHAPAVTSYANSVSLSNA
GLPQLTSSHPLTGAPQAQATMTPPPTMNLLQCNMSAGNLGIPHSQRIQSQMPVKGHISIR
SKSAPLPAAPSPHQQQLYGRSTPGMQSSARALSVQRSMNMGVNLMPTSPYNVNTMNPLNA
MGSYRMSQPMVNSSYHSNAAYMNQTSQYPMQVGMGMMGAQAYTQQPMQPNPHGNMMYTPP
PHHSYMNSPAVPKQTLNSPYMRR
NT seq 5652 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactggcaaaccccttgtacacgcaatggatcctggaggccatcaggaaggtg
aagaaacagaagcagcgtccgtcagaggagcggctctgcaatgccgtgtcaacttctcat
ggccttgaccgccacactgtactggagcagttggaactgagtgttaaagatggaacagtt
ctcaaggtcacaaacaaggggcagaactcttacaaggaccccgataatccaggtcgcttg
gctttgccaaaggccacaaagaaccaaggacggccagagggtttagactggcaccggctt
ttgaagcgggcacttgagagcctagaagaaccgggtggctcttcactgaaaagtattgag
cgtttcttgagaagtcagcgggatgtgagtgcatcctttgggggaaatactggcgcatca
tccgcttttcaccagcagctacggcttgcagtgaaacgggcgcttgctcatgggagaatt
aataaggaaggatccttgtatcagcttaatgccaagttggcagaaggaaaacaggggtgg
gagtcactagcctcactgccacctgtgtgcctgttaccccatgagaaggacaagccggtt
gccgaacccattcctatatgcagtttttgtctgggaacgaaagagtcaaaccgagaaaag
aaaccagaagagcttatatcatgcgcagactgtgggaacagcggtcacccgtcctgttta
aaattttctcccgagctgaccgtgcgtgtgaaggctcttcgatggcagtgcattgaatgc
aaaacctgcagctcatgccgagaccagggaaaaaatgcagataacatgttgttttgcgac
tcctgtgaccgtgggtttcatatggagtgctgtgagccccctctcacaaggatgccgaaa
ggcatgtggatatgtcagatttgccggcctcggaaaaaaggtcggaagttgctacacaaa
aaggctgcacaaattcgacgacgttacactaaccccatcgggcgtccaaagaaccgctta
aagaagcagagttcaacgacaaacccttcgtttggtaaaggcagaggagcacctggtcga
ggcaggaagcgcaaactttccatgtgctcgacgtcctctgacgatgatagaagctccgac
gaccacagaggctgcggcacatccgttcccttcaataagaagacaaagggccttattgat
ggcttaacaaagtttttcactccatcacctgatggacgaaaagcacgggcagaagcgctg
gactattccttgcaacgttcacggaagagggggccccgcaaatccgggcaggcagattgg
gacaatcaggaaggctgggactgcaagctggatggggaagatcatccaggaatgatatca
gaaaaggaaattgcgctcttccaggatatccaggagcaggcactgcaggtaaagaccccc
ccccccaaatgtggtttgttgtatgtttccatcctctgcaggcttcccaagctgtacttg
tgtgagttctgtctccgatacatgaaaagccgcacaatgcttcagcagcacacgaagaaa
tgcaattggttccacccacctgccaatgagatttaccgcaaggacaacctttccgtcttt
gaggtggatggaaaggtgagcaccatctactgccaaaacctctgccttctggccaagctc
ttcctcgaccacaagaccctctattatgacgtggagccctttctcttctatgtgctgacc
cagaatgactcgaaaggctgccatcttgttggatatttctccaaggagaagcactgccag
cagaagtacaacgtgtcctgcatcatgattcttccacagtaccagagaaaaggatacggc
cgcttccttatagacttcagttacctactttctaaacgagaggggcaagcaggatcccca
gaaaagccactttccgatctgggtcggctctcttacatggcgtactggaaaagtgtggta
cttgagtgtttacatcacaaccgagagcaccagctaagcatcaaaaggctcaccaagctg
actggtatctgcccccaggacattgcggccacgttgcaccaactacgtatgctggaactt
cgtggagaccgcgttgtgttggttcgtcgggaacaacaaattcagacacacatgagtcgt
ttgcaggcccggccgcgggaagtagaggtggatccagaagctttgagatggacacctgtt
attgtcaccaactctgtggtctcggatgaagaggaagcggaatctgaagaagaagaggat
gaggaggaggaggaggatgaagaacaaagaagtcctctgaaagacaacagtcaacaggtt
ttgagaagcatctcaagagagtttgaaagagaaacctgtcctgttttggaaaaggagaag
agcccacctacgctccgtccttcctccccaaactctcgttttccgaacccacgccaattg
caggatttgcttcgggatagcttgcctgccaatagtcagcctcccggaagaggccgaaga
gggagacgtgggcggcggggtagaggctttgggtcttccagtcgtgctgcggacctttta
agactgcttgccagggaacccccagggccccctaggcgaaatggggagaggggccgctct
ggatcacgaaggggcaggctgaagagactggctgatcccatgctccgtagagacttctta
gagcaacaggaaaggctggctcagcgcttcgaaagcgaacatccacagctaaggcgcttc
agtgaaagcagtgaagaggaagatgaagatgaagaagaggagaatcacagcctgcgctct
gattccccacccatcctaaccaagcccactctcaaacgcaagaagcccggagcacacaga
agacgtcgcgtccgaaggcgtaagcaccaccacaacagcagcgtagtgacagagactatt
tctgagactacccaggttctagatgagcccttcgatgactctgactcggagcgtcaaatg
ccaagactagagcccgaagaggagggcagtggccgtgatactcctttctctcccagctac
ttcccttacctcactccataccccctgctgaggcataaccgaccactgggcaagagcaga
tcaaacacagagcaagcccaggggtcggcagtacagcctactgtctctagcatgcgttcc
acagaggggtcggcctccttaccagattcctgtaatcctgcacctgtcaagaagaagggg
tggcctaagggtaaaagcagaaaacctctgcattggaagaaacgtccaggacggaaacca
ggtttcaaattaaatcgtgagcctccaccaccagttcccactagtcctcctcctgctagg
cctgggcgaaagtcaagaacccgagaggaagaggaggaggaggaggaggaagaagaagag
cctaccagagaagaatctccagaaagaaaagagccagagaaggaaattgtagaaactgta
actgaaaaagctgcagaagaagaacctaccaatactgttgtgcagccgtcctctccatct
gagagcagtagctgtagcgaaagctcatcccgggaggttgaaaatcacccagcgtcacca
gaaatgccggtgcaaactggggaagaacctcaggctgttactgaagaggctgagcaagaa
gaagaggagagaacaccagaggaaaagcctgaaacaacaactgtatccaatcagcaggaa
gatcaagatgcagatgatgaagatgagggtgcaaaggaggctgaggaaggggaggaatta
gagccagaacttgtacccgaagagccagcaccacaggagccttgtgtagtcagtagcagc
gaagaagacgacaaaggggatggtgcacaggaggcaacagaagggcctgatcctccttcc
tgcttagaagaggcggaggaatgccaagagaaagtggaagaggagcagaaagaggaagag
gaggaagcagaggaggtaataccccacactgagctagacctggagactgtgcaagctgtg
cagtcactgacccaggaggagagcagtgagcgtgatgatgggacatatggggactgtgag
gacgagacgctgacagcatgtcagactttgcaaagtttcactcaggcagaggaagacccc
cagctaagtttatctgaggagtgccatccttctgcccacgacagccctatatcctctgtc
cactcccaccccagccagtcagtgaggtcagcaagcagcccaagtgttccccaaactatg
gagaataatggaactggtgtgtacccacagattagccctgatgcaggatccctctccgct
ccttctatacagaacttagagaccaccagccccatgatggatgttccttcagtgtccgac
cactctcagcaggtggtggacagcggtttcagtgaccttggtagcattgagagcactaca
gagaactatgagaaccccagcagttatgactcaagcatggggggtggcagcatttcctcg
cagagcagctgttcatatgctagcaacagcaacgctaatggaggagggggcctgccatcc
acggctagcatggcacaaaatgggtgtgccgtaaatcagcagatggctagcatggcaagc
atgttacagccatcccaagcttgcagcattaagtcaccccagagctgtgcctcggagcga
ccccccagcagcagtaacaataaccagccaccaccccctcctcctccccctccaccattg
cctccacaacagccccagccaccgccccaacagcagcagcccccaatgtcacagtgcagc
atgaacaacagttttggtccctcgccaatgatcatggagataccagaccagagcaatggc
agcaacctcagcatctatccaggggattttggggcgggtggttacacccagccttctgcc
acctttagcctggcaaaactgcagcagctcaccaacactatcatggaccctcatgctatg
ccttacagccatgctccggcagtcacctcctatgcaaacagcgtgtccctttccaacgcg
ggccttccccaactcacctcctcccaccctctaactggggcaccccaagcacaagccacc
atgaccccccctcctaccatgaacctccttcagtgcaacatgtcggcgggcaatctcggc
attccacatagccagcgtattcaaagccagatgcctgtcaaggggcacatctccatccgc
tccaaatctgccccgcttcctgctgcaccatcccctcaccagcagcaactgtacggacgc
agcacaccaggcatgcagtcgtccgccagagcactctccgtccagcggagcatgaacatg
ggcgtcaacctcatgcccacctccccgtacaatgttaacaccatgaacccgctcaatgct
atgggcagctaccgcatgtcccagcccatggtcaacagctcctatcatagcaacgcagcc
tatatgaaccagacgtcacagtatcccatgcaggttggcatgggcatgatgggtgcccag
gcctacacccagcaacctatgcagccgaatccccatggaaatatgatgtacacacctcct
ccgcaccactcctacatgaattcccctgcagtccccaaacaaactctaaactccccctat
atgaggagatga

DBGET integrated database retrieval system