KEGG   Xenopus tropicalis (western clawed frog): 100496520Help
Entry
100496520         CDS       T01011                                 

Gene name
kat6a
Definition
(RefSeq) K(lysine) acetyltransferase 6A
  KO
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100496520 (kat6a)
Chromosome [BR:xtr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100496520 (kat6a)
   HAT complexes
    MOZ/MORF complex
     100496520 (kat6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1931 aa AA seqDB search
MVKLANPLYTQWILEAIRKVKKQKQRPSEERLCNAVSTSHGLDRHTVLEQLELSVKDGTV
LKVTNKGQNSYKDPDNPGRLALPKATKNQGRPEGLDWHRLLKRALESLEEPGGSSLKSIE
RFLRSQRDVSASFGGNTGASSAFHQQLRLAVKRALAHGRINKEGSLYQLNAKLAEGKQGW
ESLASLPPVCLLPHEKDKPVAEPIPICSFCLGTKESNREKKPEELISCADCGNSGHPSCL
KFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCEPPLTRMPK
GMWICQICRPRKKGRKLLHKKAAQIRRRYTNPIGRPKNRLKKQSSTTNPSFGKGRGAPGR
GRKRKLSMCSTSSDDDRSSDDHRGCGTSVPFNKKTKGLIDGLTKFFTPSPDGRKARAEAL
DYSLQRSRKRGPRKSGQADWDNQEGWDCKLDGEDHPGMISEKEIALFQDIQEQALQAQDG
GGGIREGRAQGSKMKQTRETIGGRKEWGVGGRSCTSVCSPPCSEVLASCANSSIGYVSIL
CRLPKLYLCEFCLRYMKSRTMLQQHTKKCNWFHPPANEIYRKDNLSVFEVDGKVSTIYCQ
NLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDSKGCHLVGYFSKEKHCQQKYNVSCIMILP
QYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVVLECLHHNREHQL
SIKRLTKLTGICPQDIAATLHQLRMLELRGDRVVLVRREQQIQTHMSRLQARPREVEVDP
EALRWTPVIVTNSVVSDEEEAESEEEEDEEEEEDEEQRSPLKDNSQQVLRSISREFERET
CPVLEKEKSPPTLRPSSPNSRFPNPRQLQDLLRDSLPANSQPPGRGRRGRRGRRGRGFGS
SSRAADLLRLLAREPPGPPRRNGERGRSGSRRGRLKRLADPMLRRDFLEQQERLAQRFES
EHPQLRRFSESSEEEDEDEEEENHSLRSDSPPILTKPTLKRKKPGAHRRRRVRRRKHHHN
SSVVTETISETTQVLDEPFDDSDSERQMPRLEPEEEGSGRDTPFSPSYFPYLTPYPLLRH
NRPLGKSRSNTEQAQGSAVQPTVSSMRSTEGSASLPDSCNPAPVKKKGWPKGKSRKPLHW
KKRPGRKPGFKLNREPPPPVPTSPPPARPGRKSRTREEEEEEEEEEEEPTREESPERKEP
EKEIVETVTEKAAEEEPTNTVVQPSSPSESSSCSESSSREVENHPASPEMPVQTGEEPQA
VTEEAEQEEEERTPEEKPETTTVSNQQEDQDADDEDEGAKEAEEGEELEPELVPEEPAPQ
EPCVVSSSEEDDKGDGAQEATEGPDPPSCLEEAEECQEKVEEEQKEEEEEAEEVIPHTEL
DLETVQAVQSLTQEESSERDDGTYGDCEDETLTACQTLQSFTQAEEDPQLSLSEECHPSA
HDSPISSVHSHPSQSVRSASSPSVPQTMENNGTGVYPQISPDAGSLSAPSIQNLETTSPM
MDVPSVSDHSQQVVDSGFSDLGSIESTTENYENPSSYDSSMGGGSISSQSSCSYASNSNA
NGGGGLPSTASMAQNGCAVNQQMASMASMLQPSQACSIKSPQSCASERPPSSSNNNQPPP
PPPPPPPLPPQQPQPPPQQQQPPMSQCSMNNSFGPSPMIMEIPDQSNGSNLSIYPGDFGA
GGYTQPSATFSLAKLQQLTNTIMDPHAMPYSHAPAVTSYANSVSLSNAGLPQLTSSHPLT
GAPQAQATMTPPPTMNLLQCNMSAGNLGIPHSQRIQSQMPVKGHISIRSKSAPLPAAPSP
HQQQLYGRSTPGMQSSARALSVQRSMNMGVNLMPTSPYNVNTMNPLNAMGSYRMSQPMVN
SSYHSNAAYMNQTSQYPMQVGMGMMGAQAYTQQPMQPNPHGNMMYTPPPHHSYMNSPAVP
KQTLNSPYMRR
NT seq 5796 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactggcaaaccccttgtacacgcaatggatcctggaggccatcaggaaggtg
aagaaacagaagcagcgtccgtcagaggagcggctctgcaatgccgtgtcaacttctcat
ggccttgaccgccacactgtactggagcagttggaactgagtgttaaagatggaacagtt
ctcaaggtcacaaacaaggggcagaactcttacaaggaccccgataatccaggtcgcttg
gctttgccaaaggccacaaagaaccaaggacggccagagggtttagactggcaccggctt
ttgaagcgggcacttgagagcctagaagaaccgggtggctcttcactgaaaagtattgag
cgtttcttgagaagtcagcgggatgtgagtgcatcctttgggggaaatactggcgcatca
tccgcttttcaccagcagctacggcttgcagtgaaacgggcgcttgctcatgggagaatt
aataaggaaggatccttgtatcagcttaatgccaagttggcagaaggaaaacaggggtgg
gagtcactagcctcactgccacctgtgtgcctgttaccccatgagaaggacaagccggtt
gccgaacccattcctatatgcagtttttgtctgggaacgaaagagtcaaaccgagaaaag
aaaccagaagagcttatatcatgcgcagactgtgggaacagcggtcacccgtcctgttta
aaattttctcccgagctgaccgtgcgtgtgaaggctcttcgatggcagtgcattgaatgc
aaaacctgcagctcatgccgagaccagggaaaaaatgcagataacatgttgttttgcgac
tcctgtgaccgtgggtttcatatggagtgctgtgagccccctctcacaaggatgccgaaa
ggcatgtggatatgtcagatttgccggcctcggaaaaaaggtcggaagttgctacacaaa
aaggctgcacaaattcgacgacgttacactaaccccatcgggcgtccaaagaaccgctta
aagaagcagagttcaacgacaaacccttcgtttggtaaaggcagaggagcacctggtcga
ggcaggaagcgcaaactttccatgtgctcgacgtcctctgacgatgatagaagctccgac
gaccacagaggctgcggcacatccgttcccttcaataagaagacaaagggccttattgat
ggcttaacaaagtttttcactccatcacctgatggacgaaaagcacgggcagaagcgctg
gactattccttgcaacgttcacggaagagggggccccgcaaatccgggcaggcagattgg
gacaatcaggaaggctgggactgcaagctggatggggaagatcatccaggaatgatatca
gaaaaggaaattgcgctcttccaggatatccaggagcaggcactgcaggcacaggatgga
ggaggaggaataagggagggtagagcccaggggagcaagatgaaacaaacaagagagacg
atcggagggagaaaagagtggggggtgggcgggagatcctgtacctcagtgtgctcccca
ccctgttcagaggtcttggcatcatgtgcaaacagctctattggatatgtttccatcctc
tgcaggcttcccaagctgtacttgtgtgagttctgtctccgatacatgaaaagccgcaca
atgcttcagcagcacacgaagaaatgcaattggttccacccacctgccaatgagatttac
cgcaaggacaacctttccgtctttgaggtggatggaaaggtgagcaccatctactgccaa
aacctctgccttctggccaagctcttcctcgaccacaagaccctctattatgacgtggag
ccctttctcttctatgtgctgacccagaatgactcgaaaggctgccatcttgttggatat
ttctccaaggagaagcactgccagcagaagtacaacgtgtcctgcatcatgattcttcca
cagtaccagagaaaaggatacggccgcttccttatagacttcagttacctactttctaaa
cgagaggggcaagcaggatccccagaaaagccactttccgatctgggtcggctctcttac
atggcgtactggaaaagtgtggtacttgagtgtttacatcacaaccgagagcaccagcta
agcatcaaaaggctcaccaagctgactggtatctgcccccaggacattgcggccacgttg
caccaactacgtatgctggaacttcgtggagaccgcgttgtgttggttcgtcgggaacaa
caaattcagacacacatgagtcgtttgcaggcccggccgcgggaagtagaggtggatcca
gaagctttgagatggacacctgttattgtcaccaactctgtggtctcggatgaagaggaa
gcggaatctgaagaagaagaggatgaggaggaggaggaggatgaagaacaaagaagtcct
ctgaaagacaacagtcaacaggttttgagaagcatctcaagagagtttgaaagagaaacc
tgtcctgttttggaaaaggagaagagcccacctacgctccgtccttcctccccaaactct
cgttttccgaacccacgccaattgcaggatttgcttcgggatagcttgcctgccaatagt
cagcctcccggaagaggccgaagagggagacgtgggcggcggggtagaggctttgggtct
tccagtcgtgctgcggaccttttaagactgcttgccagggaacccccagggccccctagg
cgaaatggggagaggggccgctctggatcacgaaggggcaggctgaagagactggctgat
cccatgctccgtagagacttcttagagcaacaggaaaggctggctcagcgcttcgaaagc
gaacatccacagctaaggcgcttcagtgaaagcagtgaagaggaagatgaagatgaagaa
gaggagaatcacagcctgcgctctgattccccacccatcctaaccaagcccactctcaaa
cgcaagaagcccggagcacacagaagacgtcgcgtccgaaggcgtaagcaccaccacaac
agcagcgtagtgacagagactatttctgagactacccaggttctagatgagcccttcgat
gactctgactcggagcgtcaaatgccaagactagagcccgaagaggagggcagtggccgt
gatactcctttctctcccagctacttcccttacctcactccataccccctgctgaggcat
aaccgaccactgggcaagagcagatcaaacacagagcaagcccaggggtcggcagtacag
cctactgtctctagcatgcgttccacagaggggtcggcctccttaccagattcctgtaat
cctgcacctgtcaagaagaaggggtggcctaagggtaaaagcagaaaacctctgcattgg
aagaaacgtccaggacggaaaccaggtttcaaattaaatcgtgagcctccaccaccagtt
cccactagtcctcctcctgctaggcctgggcgaaagtcaagaacccgagaggaagaggag
gaggaggaggaggaagaagaagagcctaccagagaagaatctccagaaagaaaagagcca
gagaaggaaattgtagaaactgtaactgaaaaagctgcagaagaagaacctaccaatact
gttgtgcagccgtcctctccatctgagagcagtagctgtagcgaaagctcatcccgggag
gttgaaaatcacccagcgtcaccagaaatgccggtgcaaactggggaagaacctcaggct
gttactgaagaggctgagcaagaagaagaggagagaacaccagaggaaaagcctgaaaca
acaactgtatccaatcagcaggaagatcaagatgcagatgatgaagatgagggtgcaaag
gaggctgaggaaggggaggaattagagccagaacttgtacccgaagagccagcaccacag
gagccttgtgtagtcagtagcagcgaagaagacgacaaaggggatggtgcacaggaggca
acagaagggcctgatcctccttcctgcttagaagaggcggaggaatgccaagagaaagtg
gaagaggagcagaaagaggaagaggaggaagcagaggaggtaataccccacactgagcta
gacctggagactgtgcaagctgtgcagtcactgacccaggaggagagcagtgagcgtgat
gatgggacatatggggactgtgaggacgagacgctgacagcatgtcagactttgcaaagt
ttcactcaggcagaggaagacccccagctaagtttatctgaggagtgccatccttctgcc
cacgacagccctatatcctctgtccactcccaccccagccagtcagtgaggtcagcaagc
agcccaagtgttccccaaactatggagaataatggaactggtgtgtacccacagattagc
cctgatgcaggatccctctccgctccttctatacagaacttagagaccaccagccccatg
atggatgttccttcagtgtccgaccactctcagcaggtggtggacagcggtttcagtgac
cttggtagcattgagagcactacagagaactatgagaaccccagcagttatgactcaagc
atggggggtggcagcatttcctcgcagagcagctgttcatatgctagcaacagcaacgct
aatggaggagggggcctgccatccacggctagcatggcacaaaatgggtgtgccgtaaat
cagcagatggctagcatggcaagcatgttacagccatcccaagcttgcagcattaagtca
ccccagagctgtgcctcggagcgaccccccagcagcagtaacaataaccagccaccaccc
cctcctcctccccctccaccattgcctccacaacagccccagccaccgccccaacagcag
cagcccccaatgtcacagtgcagcatgaacaacagttttggtccctcgccaatgatcatg
gagataccagaccagagcaatggcagcaacctcagcatctatccaggggattttggggcg
ggtggttacacccagccttctgccacctttagcctggcaaaactgcagcagctcaccaac
actatcatggaccctcatgctatgccttacagccatgctccggcagtcacctcctatgca
aacagcgtgtccctttccaacgcgggccttccccaactcacctcctcccaccctctaact
ggggcaccccaagcacaagccaccatgaccccccctcctaccatgaacctccttcagtgc
aacatgtcggcgggcaatctcggcattccacatagccagcgtattcaaagccagatgcct
gtcaaggggcacatctccatccgctccaaatctgccccgcttcctgctgcaccatcccct
caccagcagcaactgtacggacgcagcacaccaggcatgcagtcgtccgccagagcactc
tccgtccagcggagcatgaacatgggcgtcaacctcatgcccacctccccgtacaatgtt
aacaccatgaacccgctcaatgctatgggcagctaccgcatgtcccagcccatggtcaac
agctcctatcatagcaacgcagcctatatgaaccagacgtcacagtatcccatgcaggtt
ggcatgggcatgatgggtgcccaggcctacacccagcaacctatgcagccgaatccccat
ggaaatatgatgtacacacctcctccgcaccactcctacatgaattcccctgcagtcccc
aaacaaactctaaactccccctatatgaggagatga

DBGET integrated database retrieval system