KEGG   Xenopus tropicalis (western clawed frog): 100496658Help
Entry
100496658         CDS       T01011                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1-like
Orthology
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100496658
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100496658
   04370 VEGF signaling pathway
    100496658
   04020 Calcium signaling pathway
    100496658
   04070 Phosphatidylinositol signaling system
    100496658
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100496658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1227 aa AA seqDB search
DVREIKEIRPGKNSRDFERYPEDTRKLDATLCFIILYGTDFRLKTVSAAAFSEEEVNLWI
SGLNWVVADTLKAPGPLQIERWLGKQFNAVDRAREGSVTVKDLKALLPQVNYRVPNMRFL
RDKMLEIEARSELTFPHFVLFYNNLMFDAQKSIIEQLELSFPLRNVDRPSLCQISLYDFQ
RFLQFDQKEAWAGDINKVRGYLCNYLKDSDGDVCEPILQLDEFLTYLFSKENMIMDSRFE
QVVPEEMTYPLSQYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDDL
PIIYHGHTLTSKIKFLDVLHTIKDNAFVTSEYPVILSIEDHCSVVQQRNMAHYFRKVFGD
MLLTKPVDINADELPSPAQLKKKILIKHKKLVEGNLYEEVSTASYSENDISNSIKNGILY
LEDPIDHTWSPHYFVLTSNKIYYSEETSRYQSNDEDEEMEPKEEFNNNELHFSEKWFHGK
LGGGRDGRQIAEKLLHEYCTETGGKDGTFLVRESETFVGDYTLSFWRSSRVQHCRIHSRQ
EAGSTKFYLTDNLVFDSLYGLISHYREVPLRCNEFEMRLTDPVPQPNAHESKEWYHANLT
RLQAEHMLMRVPRDGAFLLRKRSETSSFAISFRAEGKIKHCRIQQEGRLFMLGSSAEFES
LVDLISYYEKHPLYRKMRLRYPINEEALEKMGTAELDYDALFEGRTPHVYVEANKMPTSR
CTVKALYDYKAQREDELTFCKQAIIHNVDKQDGGWWRGDYGGKKQLWFPANYVEETTSAM
SPDQDEGSFYFGQSVENSPLGNFLKGFIDVPSCHIVSSKDGRSSRPYVFTIHSQQMSHPS
QSLDVAADTQEELNDWIGKIREATQNADARMQEGKIMERRKKIALELSELVVYCRPVPFD
EEKIGTEKACYRDMSSFPETKAEKYANRSKGKKFLQYNRRQLSRVYPKGQRLDSSNYDPL
PMWICGSQLVALNFQTPDKPMQLNQALFMLGGQSGYVLQPDIMRDDLFDPFDKNSLKIVE
PITVQLQILGARHLPKNGRSIVCPFIEVEVCGSEFDNSKSKSDVVADNGLNPVWMMKQFV
FDITNPEFAFLRFVVYEEDMFSDPNFLAQATFSVKGLKTGYRSVPLRNSYSEELELASLL
VHIEIVNAKEEDDENLYTSIQQLRDRASELSSQVSSYERANNCDSRYQQRLDELRAAQER
LMELTEVRNRKLMEKKKRERQLANKRN
NT seq 3686 nt NT seq  +upstreamnt  +downstreamnt
ttgatgtcagagagattaaggagatccggccggggaagaactcccgggattttgaacgct
accctgaagatacccggaagctggacgctaccctctgcttcatcatcttgtatggaaccg
acttccgcctgaagactgtcagtgctgctgctttcagtgaggaagaggtaaatctatgga
tcagcggtttaaactgggtcgtcgcagatacgctgaaggctccaggccctctccagatcg
agaggtggctcggaaaacagttcaacgcagtggacagagcgagagaaggcagcgtgacgg
tgaaggatctgaaagctctgctccctcaggttaattaccgcgtgcctaacatgagatttc
tacgggacaaaatgctggaaatcgaggcccgatcggagctgaccttcccacactttgttc
tgttttacaataacttgatgtttgatgctcagaaatcaatcattgagcagctcgagttgt
ctttccctttaaggaacgttgatcggccttctctatgccagatctctttgtatgacttcc
agaggtttcttcagtttgatcagaaggaagcctgggccggtgacattaataaggttcggg
gttacctatgcaattacctgaaggacagcgatggggacgtctgtgaacccattctgcagt
tggatgagttcctgacctacctcttctccaaggagaacatgatcatggactctaggtttg
agcaagtggtgccggaggagatgacctacccgctgtcccagtactggatctcatcctcac
acaacacatatttgactggggatcagttctccagcgagtcatccttagaagcttacgctc
gctgcctccggatgggctgccgctgcattgagttggactgctgggatggaccagatgacc
tgcctattatctatcatggacacaccttgacctctaaaatcaagtttttggatgtactgc
acactatcaaggataatgcctttgtcacatcagaatatccggttatcttgtccattgagg
atcactgcagtgttgtccagcagaggaacatggcccattatttcagaaaggtatttgggg
acatgttactgaccaaaccagtggacatcaatgcggacgagctcccctctccggcccagc
tcaaaaagaagattctcattaagcacaagaagctggtagaggggaacctttatgaggagg
tctcaaccgcgagctactcggagaatgacatcagtaactctatcaagaacgggatcctct
acctagaagatcccatagaccatacctggagccctcactatttcgtcttaacaagtaaca
agatctactactccgaggagacgtctcggtaccagtccaacgatgaggacgaagagatgg
aacccaaagaggagtttaataacaatgagctgcacttcagtgagaagtggttccacggga
agctggggggcgggcgcgacgggcgccagattgccgagaagctgctgcacgagtactgca
cggagacggggggaaaggacggcacattcctagtgcgtgagagcgagaccttcgttggcg
actacaccttgtcattctggcgctccagcagggtccagcactgccgcatccactctcggc
aggaggccggctccaccaaattctacctgacagacaacctggtgtttgacagcctgtatg
gcctgatcagccactaccgggaggtgccgctgcgctgcaatgagtttgagatgaggctca
ccgaccccgttccgcagcccaacgcacacgagagcaaagagtggtaccatgccaatctca
cccgcctgcaggcggagcatatgctgatgagagttccccgagacggtgccttcctgttgc
gcaagcggagcgagaccagctcattcgctatttccttcagggccgagggcaagatcaagc
actgccggatacagcaggagggccgactcttcatgttgggcagctccgcagagttcgaga
gcctggtcgacctcattagttactatgagaagcatccgctgtaccgcaagatgaggctcc
gctatcccatcaacgaggaagcgctggagaagatgggcacggcggaactggactacgatg
ctctgtttgagggtagaaccccccatgtttacgtggaggccaacaagatgcccacatcaa
ggtgcacggtgaaagcgctgtacgattacaaggcccagcgggaggatgagctgacgttct
gcaagcaagccattatacacaatgtggacaaacaagatggcggctggtggcgaggggatt
acggaggcaaaaagcaactttggttccctgctaattacgtagaagagacaacgagcgcga
tgtccccagatcaggatgagggctctttctattttggccagtcggtagagaacagcccct
tggggaacttcctgaaaggatttatcgatgtgccttcctgccacatagtctcatcgaagg
acggaaggagctcgcggccgtacgtcttcaccatccactcccagcaaatgtcccacccct
ctcagtccttggacgtggctgctgacactcaggaagagctcaatgattggatcggcaaaa
tccgagaggccactcaaaacgcagatgctcggatgcaggaagggaaaatcatggagcgga
ggaagaagattgccctcgagctgtcggagcttgttgtctattgccggccagttccgttcg
atgaggaaaagattggcacagagaaggcttgctaccgtgacatgtcttcattccccgaga
ccaaggcagagaagtacgccaaccgcagcaaaggcaagaaattcctgcagtacaaccgac
gccagctgagcagggtttacccaaagggccagcgcctggactcctccaattatgacccac
tgcccatgtggatctgtggcagccagctggtggctctgaacttccagaccccagacaagc
cgatgcagctgaaccaagcactgttcatgctggggggccagagcggctatgtcctgcagc
cggacatcatgagagacgacctttttgatcccttcgataagaacagcttgaagattgtgg
agccaatcacagtgcagcttcagatattaggagccaggcacctccccaaaaatgggcgga
gtatcgtttgccccttcatagaagtggaagtttgtggctcagaattcgacaacagcaaaa
gcaaaagtgacgtggtggcggataatggactgaaccctgtgtggatgatgaagcagtttg
tgtttgacatcaccaacccagagtttgccttcctgcgattcgtggtgtacgaggaggaca
tgttcagtgaccccaacttcttggcccaagccacgttctctgtcaaggggctgaaaacag
gttaccgctccgtgccgctgaggaacagctacagcgaagagttggagttggcctcactgt
tggtgcacatagagattgtcaatgccaaggaggaagacgacgagaatctctacacctcca
tccagcagctgagggaccgggccagcgaattgtccagccaggtttccagctacgaacggg
ccaataactgcgactctcgctaccagcagagactggacgagctgcgggcagcccaggagc
gactcatggaacttacggaagtgcgcaacaggaagctgatggagaagaagaagagagaga
gacagttagcgaacaagcggaactga

DBGET integrated database retrieval system