KEGG   Xenopus tropicalis (western clawed frog): 100496658Help
Entry
100496658         CDS       T01011                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1-like
  KO
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100496658
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100496658
   04370 VEGF signaling pathway
    100496658
   04020 Calcium signaling pathway
    100496658
   04070 Phosphatidylinositol signaling system
    100496658
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100496658
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100496658
Membrane trafficking [BR:xtr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100496658
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100496658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
6
AA seq 1301 aa AA seqDB search
MFGCRMANLNGLMEEGRGEGTDLGRTLRSLETGTVLTLFYQKKSQRPERRTFQLRMDTRQ
VVWFRTTEKVEGDIDVREIKEIRPGKNSRDFERYPEDTRKLDATLCFIILYGTDFRLKTV
SAAAFSEEEVNLWISGLNWVVADTLKAPGPLQIERWLGKQFNAVDRAREGSVTVKDLKAL
LPQVNYRVPNMRFLRDKMLEIEARSELTFPHFVLFYNNLMFDAQKSIIEQLELSFPLRNV
DRPSLCQISLYDFQRFLQFDQKEAWAGDINKVRGYLCNYLKDSDGDVCEPILQLDEFLTY
LFSKENMIMDSRFEQVVPEEMTYPLSQYWISSSHNTYLTGDQFSSESSLEAYARCLRMGC
RCIELDCWDGPDDLPIIYHGHTLTSKIKFLDVLHTIKDNAFVTSEYPVILSIEDHCSVVQ
QRNMAHYFRKVFGDMLLTKPVDINADELPSPAQLKKKILIKHKKLVEGNLYEEVSTASYS
ENDISNSIKNGILYLEDPIDHTWSPHYFVLTSNKIYYSEETSRYQSNDEDEEMEPKEEFN
NNELHFSEKWFHGKLGGGRDGRQIAEKLLHEYCTETGGKDGTFLVRESETFVGDYTLSFW
RSSRVQHCRIHSRQEAGSTKFYLTDNLVFDSLYGLISHYREVPLRCNEFEMRLTDPVPQP
NAHESKEWYHANLTRLQAEHMLMRVPRDGAFLLRKRSETSSFAISFRAEGKIKHCRIQQE
GRLFMLGSSAEFESLVDLISYYEKHPLYRKMRLRYPINEEALEKMGTAELDYDALFEGRT
PHVYVEANKMPTSRCTVKALYDYKAQREDELTFCKQAIIHNVDKQDGGWWRGDYGGKKQL
WFPANYVEETTSAMSPDQDEGSFYFGQSVENSPLGNFLKGFIDVPSCHIVSSKDGRSSRP
YVFTIHSQQMSHPSQSLDVAADTQEELNDWIGKIREATQNADARMQEGKIMERRKKIALE
LSELVVYCRPVPFDEEKIGTEKACYRDMSSFPETKAEKYANRSKGKKFLQYNRRQLSRVY
PKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQLNQALFMLGGQSGYVLQPDIMRDD
LFDPFDKNSLKIVEPITVQLQILGARHLPKNGRSIVCPFIEVEVCGSEFDNSKSKSDVVA
DNGLNPVWMMKQFVFDITNPEFAFLRFVVYEEDMFSDPNFLAQATFSVKGLKTGYRSVPL
RNSYSEELELASLLVHIEIVNAKEEDDENLYTSIQQLRDRASELSSQVSSYERANNCDSR
YQQRLDELRAAQERLMELTEVRNRKLMEKKKRERQLANKRN
NT seq 3906 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggtgcaggatggccaacctgaatggattgatggaggagggcaggggggagggc
acggacctgggtcggaccctgcggagcctggagaccggtacggtactgaccctgttctac
caaaagaagtcacagcggccggagagacggacgttccagcttagaatggacaccaggcag
gttgtgtggtttcggaccacggagaaggtggaaggagacattgatgtcagagagattaag
gagatccggccggggaagaactcccgggattttgaacgctaccctgaagatacccggaag
ctggacgctaccctctgcttcatcatcttgtatggaaccgacttccgcctgaagactgtc
agtgctgctgctttcagtgaggaagaggtaaatctatggatcagcggtttaaactgggtc
gtcgcagatacgctgaaggctccaggccctctccagatcgagaggtggctcggaaaacag
ttcaacgcagtggacagagcgagagaaggcagcgtgacggtgaaggatctgaaagctctg
ctccctcaggttaattaccgcgtgcctaacatgagatttctacgggacaaaatgctggaa
atcgaggcccgatcggagctgaccttcccacactttgttctgttttacaataacttgatg
tttgatgctcagaaatcaatcattgagcagctcgagttgtctttccctttaaggaacgtt
gatcggccttctctatgccagatctctttgtatgacttccagaggtttcttcagtttgat
cagaaggaagcctgggccggtgacattaataaggttcggggttacctatgcaattacctg
aaggacagcgatggggacgtctgtgaacccattctgcagttggatgagttcctgacctac
ctcttctccaaggagaacatgatcatggactctaggtttgagcaagtggtgccggaggag
atgacctacccgctgtcccagtactggatctcatcctcacacaacacatatttgactggg
gatcagttctccagcgagtcatccttagaagcttacgctcgctgcctccggatgggctgc
cgctgcattgagttggactgctgggatggaccagatgacctgcctattatctatcatgga
cacaccttgacctctaaaatcaagtttttggatgtactgcacactatcaaggataatgcc
tttgtcacatcagaatatccggttatcttgtccattgaggatcactgcagtgttgtccag
cagaggaacatggcccattatttcagaaaggtatttggggacatgttactgaccaaacca
gtggacatcaatgcggacgagctcccctctccggcccagctcaaaaagaagattctcatt
aagcacaagaagctggtagaggggaacctttatgaggaggtctcaaccgcgagctactcg
gagaatgacatcagtaactctatcaagaacgggatcctctacctagaagatcccatagac
catacctggagccctcactatttcgtcttaacaagtaacaagatctactactccgaggag
acgtctcggtaccagtccaacgatgaggacgaagagatggaacccaaagaggagtttaat
aacaatgagctgcacttcagtgagaagtggttccacgggaagctggggggcgggcgcgac
gggcgccagattgccgagaagctgctgcacgagtactgcacggagacggggggaaaggac
ggcacattcctagtgcgtgagagcgagaccttcgttggcgactacaccttgtcattctgg
cgctccagcagggtccagcactgccgcatccactctcggcaggaggccggctccaccaaa
ttctacctgacagacaacctggtgtttgacagcctgtatggcctgatcagccactaccgg
gaggtgccgctgcgctgcaatgagtttgagatgaggctcaccgaccccgttccgcagccc
aacgcacacgagagcaaagagtggtaccatgccaatctcacccgcctgcaggcggagcat
atgctgatgagagttccccgagacggtgccttcctgttgcgcaagcggagcgagaccagc
tcattcgctatttccttcagggccgagggcaagatcaagcactgccggatacagcaggag
ggccgactcttcatgttgggcagctccgcagagttcgagagcctggtcgacctcattagt
tactatgagaagcatccgctgtaccgcaagatgaggctccgctatcccatcaacgaggaa
gcgctggagaagatgggcacggcggaactggactacgatgctctgtttgagggtagaacc
ccccatgtttacgtggaggccaacaagatgcccacatcaaggtgcacggtgaaagcgctg
tacgattacaaggcccagcgggaggatgagctgacgttctgcaagcaagccattatacac
aatgtggacaaacaagatggcggctggtggcgaggggattacggaggcaaaaagcaactt
tggttccctgctaattacgtagaagagacaacgagcgcgatgtccccagatcaggatgag
ggctctttctattttggccagtcggtagagaacagccccttggggaacttcctgaaagga
tttatcgatgtgccttcctgccacatagtctcatcgaaggacggaaggagctcgcggccg
tacgtcttcaccatccactcccagcaaatgtcccacccctctcagtccttggacgtggct
gctgacactcaggaagagctcaatgattggatcggcaaaatccgagaggccactcaaaac
gcagatgctcggatgcaggaagggaaaatcatggagcggaggaagaagattgccctcgag
ctgtcggagcttgttgtctattgccggccagttccgttcgatgaggaaaagattggcaca
gagaaggcttgctaccgtgacatgtcttcattccccgagaccaaggcagagaagtacgcc
aaccgcagcaaaggcaagaaattcctgcagtacaaccgacgccagctgagcagggtttac
ccaaagggccagcgcctggactcctccaattatgacccactgcccatgtggatctgtggc
agccagctggtggctctgaacttccagaccccagacaagccgatgcagctgaaccaagca
ctgttcatgctggggggccagagcggctatgtcctgcagccggacatcatgagagacgac
ctttttgatcccttcgataagaacagcttgaagattgtggagccaatcacagtgcagctt
cagatattaggagccaggcacctccccaaaaatgggcggagtatcgtttgccccttcata
gaagtggaagtttgtggctcagaattcgacaacagcaaaagcaaaagtgacgtggtggcg
gataatggactgaaccctgtgtggatgatgaagcagtttgtgtttgacatcaccaaccca
gagtttgccttcctgcgattcgtggtgtacgaggaggacatgttcagtgaccccaacttc
ttggcccaagccacgttctctgtcaaggggctgaaaacaggttaccgctccgtgccgctg
aggaacagctacagcgaagagttggagttggcctcactgttggtgcacatagagattgtc
aatgccaaggaggaagacgacgagaatctctacacctccatccagcagctgagggaccgg
gccagcgaattgtccagccaggtttccagctacgaacgggccaataactgcgactctcgc
taccagcagagactggacgagctgcgggcagcccaggagcgactcatggaacttacggaa
gtgcgcaacaggaagctgatggagaagaagaagagagagagacagttagcgaacaagcgg
aactga

DBGET integrated database retrieval system