KEGG   Xenopus tropicalis (western clawed frog): 100496674Help
Entry
100496674         CDS       T01011                                 

Gene name
plcg1, nckap3, plc-ii, plc1, plc148, plcgamma1
Definition
(RefSeq) phospholipase C gamma 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 1269 aa AA seqDB search
MESLPLLNGFAPCGQSEAELTHLCRSLEVGTVMTLFYSKKSQKPERRTFQVKLETRQVTW
SRVADKVEGAVDIREIKEIRPSKNSRDFDRYQEDPTVRLEQAHCFVILYGTEFRLKTLSL
QATSEEEVNMWIKGLNWLLQDTLQAPTPLQIERWLRKQFYTLDRNREDKISVKDLKNMLS
QVNYRVPNMRFLRDRLMELEQRSREINYAQFAILYRSLMYDAQKTIPIPFTERFGERERT
KVSLEDFQKFLLDYQKEMWATDLHKVREFMFHFLHDPLREIEEPYFTLEEFVSFLFSKEN
TVWDSELDTVCPQNMDNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELD
CWDGPDGMPVIYHGHTLTTKIKFSEVLTTIKEHAFVTSEYPVILSIEDHCSIAQQRNMAQ
HFKKVFGDMLLTKPVDVNADGLPSPNQLKRKILIKHKKLAEGSTYEEIPASTVYSENDIS
NSIKNGILYLQDPINHEWYPHFFVLTSSKIYYSEETTGSQANDDEEEQKEASNSSELHSA
EKWFHGKLGAGRDGRHIAERLLTDYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQH
CRIHSRQEAGSPKFFLTDNLVFESLYALITHYQQMPLRCNEFEMRLTEPVPQTNAHESKE
WYHASLTRGQAEHMLMRVPRDGAFLVRKRSEQNSYAISFRAEGKIKHCRVIQEGQSVVLG
SSEFDSLVDLISYYEKHPLYRKMKLRYPINEETLEKIGTPDPDYGALYEGRNPGFYVEAN
PMPTFKCSVRALFDYKAQREDELTFTKNTIIQNVEKQEGGWWRGDCGGKKQMWFPANYVE
EIFSPAEPEPERQHLDENSPLGDLLGGVLDVPSCHIVPRPDVFNGRPFVFTITGPQLNRY
PLDVAADTMEDMQDWIRKIREAAQTADARLTEGKIMERRKKIALELSELVIYCRPVPFDE
EKIGTEKACYRDMSSFPETKAEKYVNKLKGKKFLQYNRRQLSRIYPKGQRLDSSNYDPLP
MWICGSQLVALNFQTPDKPMQMNQALFHSGGRCGYVFQPSSMRDEMFDPFDKGTLRQETI
TISIEILGARHLPKIGRGIVCPFVEVEVCGTEYDNAKQKTEFVVDNGLNPIWPQKTFPFV
VANPEFAFLRFVVYEEDMFSDQNFLAQASFVVRGLKTGYRAIPLKNNYTEDLELASLLIK
IDIKTENGELNGASAPRERISDPMSGRIWDGPTDTRYHSNHLDDFRAXEQFERERRVLRK
TRLSGDNRL
NT seq 3810 nt NT seq  +upstreamnt  +downstreamnt
atggaatccctgccgcttctcaatgggttcgctccatgtgggcaaagtgaagccgagctc
acccatctgtgccggagtttggaggtgggcaccgtcatgaccctcttctactccaagaag
tcccagaagccggagaggaggactttccaggtgaagctggagaccaggcaggtgacatgg
agcagagtggcggataaagtggaaggggcagtggatattcgggaaattaaggagattcga
cctagcaagaactccagagatttcgaccggtaccaggaggacccaacggtgcggttggag
caggctcattgcttcgttatattgtacggaacagagttcagactgaagaccttgagccta
caagccacctccgaggaggaagtaaacatgtggattaaagggttaaactggctgcttcag
gatacactgcaggcgcctactcctctgcagattgagaggtggctccggaagcagttctac
acattggaccgcaacagggaagacaagatttctgtcaaagacctaaagaatatgctgtcc
caggttaattacagggtccccaatatgaggttcctgcgtgaccgactaatggaactggaa
caaagaagccgagagattaactatgcccagtttgccatactctaccgatcccttatgtat
gatgcacagaaaacgatcccaattccctttacagagaggtttggtgagcgtgaaaggacc
aaagtatccctagaggacttccaaaagttcttgctggattatcaaaaggagatgtgggca
actgatctgcacaaagtgcgggagttcatgttccacttcctgcatgaccctttgagggag
atcgaagagccatatttcactctggaagagtttgtatctttcctgttctctaaggagaat
acagtgtgggattcagaactggacacagtgtgtccccaaaatatggacaaccctttgtct
cattactggatatcctcttcccacaacacgtacctaacaggggatcagttctccagtgaa
tcttcattggaagcctacgctcgctgcctgcgcatgggctgtcgctgcatagaattggac
tgctgggatgggccagatggaatgccagttatttaccatgggcatacgctgaccaccaaa
ataaagttctccgaagtcttaaccaccatcaaggaacatgcttttgtcacatcagaatac
ccagttatcttatcaattgaagaccactgcagcattgcacaacaaagaaatatggctcag
cactttaagaaggtttttggggacatgctcctgaccaagcccgtggatgtcaacgctgat
ggccttccctctcccaaccaactgaaacggaaaatcctcatcaagcacaagaagctggca
gaagggagcacttatgaagagataccggcctccactgtctactcggaaaatgacatcagc
aactccatcaagaatggaattttgtacctgcaagatcccatcaatcacgagtggtaccca
catttctttgtcctcaccagcagcaagatctattattcagaggagaccaccggcagccag
gctaacgatgacgaggaggaacagaaggaggccagtaacagctcagagctgcactctgct
gaaaagtggttccacgggaagctgggtgcaggaagggatggacggcacattgcagaacgg
ctgctgacagattactgtattgaaactggggctccagatggctcctttctggtgcgggag
agtgagacatttgtgggggattacacactctccttctggagaaatggaaaagttcagcac
tgtaggatacactccaggcaagaagctggtagtccgaaattcttcctgacagataatctg
gtgtttgagagtctgtatgctctgattactcactaccagcaaatgcccctgaggtgcaac
gagtttgagatgagactgacagagccggttccacagactaatgcccacgagagcaaggag
tggtatcatgccagccttacccgggggcaagcagaacacatgttgatgagagttccccga
gacggagccttcttggtgcgcaagaggagtgaacagaactcatatgccatctccttcaga
gccgaggggaagatcaaacactgccgggtaatacaggaaggtcaaagcgttgtccttgga
agctcagagttcgacagcctggtggatttaataagttactatgagaagcaccctctgtat
cggaagatgaagctgcgttaccccattaatgaagaaacgcttgaaaagatcggcacccct
gatccagattatggtgctttatacgagggaaggaatcctggtttctatgtggaggccaat
ccaatgcctacatttaagtgctctgtcagggccttgtttgattataaggctcaacgtgag
gatgaattgactttcaccaagaatacaatcatccagaacgtagagaagcaagagggagga
tggtggcgaggcgactgcgggggtaaaaagcagatgtggttccctgccaactacgtggaa
gagatatttagtccagctgagcctgagcctgagagacagcatctggatgagaacagtcct
ctaggagatcttctgggtggagttttggatgtgccgtcctgtcacattgttcctcgacca
gatgtctttaatggtcgaccctttgtattcaccattaccgggcctcagttgaatcgatat
ccacttgacgttgctgcggacacaatggaagacatgcaagactggataagaaaaattcgg
gaagccgctcagactgcagatgcacggctcacggaaggcaaaatcatggagcgcaggaag
aagattgccctggaactctcagaacttgtcatctactgccggccagttccctttgacgaa
gagaagattggcactgagaaggcctgttaccgtgacatgtcctccttccctgagaccaaa
gcagaaaagtatgtcaacaagttgaaagggaagaaatttctacagtacaaccggcggcag
ctatctcgtatctatcccaaaggacaacgtcttgattcatcaaactatgatcccctgcca
atgtggatctgtggcagtcaacttgtagcgctcaacttccagactccagacaaacccatg
caaatgaaccaggctcttttccactccgggggtcgttgcggttatgtttttcagccaagt
agcatgagggatgaaatgttcgatccatttgacaaaggcaccctacgccaggagacaata
accatcagcattgagatcctaggtgcccgccatctgcccaagattggaaggggtattgtc
tgcccttttgtggaggtagaagtttgtggtactgaatatgacaatgcaaagcagaagaca
gaatttgtagtggataatggcttgaatcccatctggccacagaaaaccttcccctttgtc
gttgctaaccccgagtttgctttcctacggtttgtggtctatgaagaggacatgtttagt
gatcagaacttcttggcccaagcctcgtttgtggtccgtggcttgaaaacaggatataga
gccatcccactcaaaaataattacactgaggatctggaactggcatcactgctcattaag
atagacatcaagaccgagaacggagaacttaatggagcttctgcacccagggaacggatc
agtgaccctatgtctgggcgcatttgggatgggccgacagacacgcgatatcattccaac
catctggatgatttccgtgccntcgaacaatttgaaagagaaaggagagtcctcaggaaa
acgcgtctaagtggggataaccggctgtag

DBGET integrated database retrieval system