KEGG   Xenopus tropicalis (western clawed frog): 100496674Help
Entry
100496674         CDS       T01011                                 

Gene name
plcg1, nckap3, plc-ii, plc1, plc148, plcgamma1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  
phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100496674 (plcg1)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100496674 (plcg1)
   04370 VEGF signaling pathway
    100496674 (plcg1)
   04020 Calcium signaling pathway
    100496674 (plcg1)
   04070 Phosphatidylinositol signaling system
    100496674 (plcg1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100496674 (plcg1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100496674 (plcg1)
Membrane trafficking [BR:xtr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100496674 (plcg1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100496674 (plcg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Xenbase: 
Position
10
AA seq 1262 aa AA seqDB search
MESLPLLNGFAPCGQSEAELTHLCRSLEVGTVMTLFYSKKSQKPERRTFQVKLETRQVTW
SRVADKVEGAVDIREIKEIRPSKNSRDFDRYQEDPTVRLEQAHCFVILYGTEFRLKTLSL
QATSEEEVNMWIKGLNWLLQDTLQAPTPLQIERWLRKQFYTLDRNREDKISVKDLKNMLS
QVNYRVPNMRFLRDRLMELEQRSREINYAQFAILYRSLMYDAQKTIPIPFTERFGERERT
KVSLEDFQKFLLDYQKEMWATDLHKVREFMFHFLHDPLREIEEPYFTLEEFVSFLFSKEN
TVWDSELDTVCPQNMDNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIELD
CWDGPDGMPVIYHGHTLTTKIKFSEVLTTIKEHAFVTSEYPVILSIEDHCSIAQQRNMAQ
HFKKVFGDMLLTKPVDVNADGLPSPNQLKRKILIKHKKLAEGSTYEEIPASTVYSENDIS
NSIKNGILYLQDPINHEWYPHFFVLTSSKIYYSEETTGSQANDDEEEQKEASNSSELHSA
EKWFHGKLGAGRDGRHIAERLLTDYCIETGAPDGSFLVRESETFVGDYTLSFWRNGKVQH
CRIHSRQEAGSPKFFLTDNLVFESLYALITHYQQMPLRCNEFEMRLTEPVPQTNAHESKE
WYHASLTRGQAEHMLMRVPRDGAFLVRKRSEQNSYAISFRAEGKIKHCRVIQEGQSVVLG
SSEFDSLVDLISYYEKHPLYRKMKLRYPINEETLEKIGTPDPDYGALYEGRNPGFYVEAN
PMPTFKCSVRALFDYKAQREDELTFTKNTIIQNVEKQEGGWWRGDCGGKKQMWFPANYVE
EIFSPAEPEPERQHLDENSPLGDLLGGVLDVPSCHIVPRPDVFNGRPFVFTITGPQLNRY
PLDVAADTMEDMQDWIRKIREAAQTADARLTEGKIMERRKKIALELSELVIYCRPVPFDE
EKIGTEKACYRDMSSFPETKAEKYVNKLKGKKFLQYNRRQLSRIYPKGQRLDSSNYDPLP
MWICGSQLVALNFQTPDKPMQMNQALFHSGGRCGYVFQPSSMRDEMFDPFDKGTLRQETI
TISIEILGARHLPKIGRGIVCPFVEVEVCGTEYDNAKQKTEFVVDNGLNPIWPQKTFPFV
VANPEFAFLRFVVYEEDMFSDQNFLAQASFVVRGLKTGYRAIPLKNNYTEDLELASLLIK
IDIKTENGELNGASAPRERISDPMSGRIWDGPTDTRYHSNHLDDFRASNNLKEKGESSGK
RV
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atggaatccctgccgcttctcaatgggttcgctccatgtgggcaaagtgaagccgagctc
acccatctgtgccggagtttggaggtgggcaccgtcatgaccctcttctactccaagaag
tcccagaagccggagaggaggactttccaggtgaagctggagaccaggcaggtgacatgg
agcagagtggcggataaagtggaaggggcagtggatattcgggaaattaaggagattcga
cctagcaagaactccagagatttcgaccggtaccaggaggacccaacggtgcggttggag
caggctcattgcttcgttatattgtacggaacagagttcagactgaagaccttgagccta
caagccacctccgaggaggaagtaaacatgtggattaaagggttaaactggctgcttcag
gatacactgcaggcgcctactcctctgcagattgagaggtggctccggaagcagttctac
acattggaccgcaacagggaagacaagatttctgtcaaagacctaaagaatatgctgtcc
caggttaattacagggtccccaatatgaggttcctgcgtgaccgactaatggaactggaa
caaagaagccgagagattaactatgcccagtttgccatactctaccgatcccttatgtat
gatgcacagaaaacgatcccaattccctttacagagaggtttggtgagcgtgaaaggacc
aaagtatccctagaggacttccaaaagttcttgctggattatcaaaaggagatgtgggca
actgatctgcacaaagtgcgggagttcatgttccacttcctgcatgaccctttgagggag
atcgaagagccatatttcactctggaagagtttgtatctttcctgttctctaaggagaat
acagtgtgggattcagaactggacacagtgtgtccccaaaatatggacaaccctttgtct
cattactggatatcctcttcccacaacacgtacctaacaggggatcagttctccagtgaa
tcttcattggaagcctacgctcgctgcctgcgcatgggctgtcgctgcatagaattggac
tgctgggatgggccagatggaatgccagttatttaccatgggcatacgctgaccaccaaa
ataaagttctccgaagtcttaaccaccatcaaggaacatgcttttgtcacatcagaatac
ccagttatcttatcaattgaagaccactgcagcattgcacaacaaagaaatatggctcag
cactttaagaaggtttttggggacatgctcctgaccaagcccgtggatgtcaacgctgat
ggccttccctctcccaaccaactgaaacggaaaatcctcatcaagcacaagaagctggca
gaagggagcacttatgaagagataccggcctccactgtctactcggaaaatgacatcagc
aactccatcaagaatggaattttgtacctgcaagatcccatcaatcacgagtggtaccca
catttctttgtcctcaccagcagcaagatctattattcagaggagaccaccggcagccag
gctaacgatgacgaggaggaacagaaggaggccagtaacagctcagagctgcactctgct
gaaaagtggttccacgggaagctgggtgcaggaagggatggacggcacattgcagaacgg
ctgctgacagattactgtattgaaactggggctccagatggctcctttctggtgcgggag
agtgagacatttgtgggggattacacactctccttctggagaaatggaaaagttcagcac
tgtaggatacactccaggcaagaagctggtagtccgaaattcttcctgacagataatctg
gtgtttgagagtctgtatgctctgattactcactaccagcaaatgcccctgaggtgcaac
gagtttgagatgagactgacagagccggttccacagactaatgcccacgagagcaaggag
tggtatcatgccagccttacccgggggcaagcagaacacatgttgatgagagttccccga
gacggagccttcttggtgcgcaagaggagtgaacagaactcatatgccatctccttcaga
gccgaggggaagatcaaacactgccgggtaatacaggaaggtcaaagcgttgtccttgga
agctcagagttcgacagcctggtggatttaataagttactatgagaagcaccctctgtat
cggaagatgaagctgcgttaccccattaatgaagaaacgcttgaaaagatcggcacccct
gatccagattatggtgctttatacgagggaaggaatcctggtttctatgtggaggccaat
ccaatgcctacatttaagtgctctgtcagggccttgtttgattataaggctcaacgtgag
gatgaattgactttcaccaagaatacaatcatccagaacgtagagaagcaagagggagga
tggtggcgaggcgactgcgggggtaaaaagcagatgtggttccctgccaactacgtggaa
gagatatttagtccagctgagcctgagcctgagagacagcatctggatgagaacagtcct
ctaggagatcttctgggtggagttttggatgtgccgtcctgtcacattgttcctcgacca
gatgtctttaatggtcgaccctttgtattcaccattaccgggcctcagttgaatcgatat
ccacttgacgttgctgcggacacaatggaagacatgcaagactggataagaaaaattcgg
gaagccgctcagactgcagatgcacggctcacggaaggcaaaatcatggagcgcaggaag
aagattgccctggaactctcagaacttgtcatctactgccggccagttccctttgacgaa
gagaagattggcactgagaaggcctgttaccgtgacatgtcctccttccctgagaccaaa
gcagaaaagtatgtcaacaagttgaaagggaagaaatttctacagtacaaccggcggcag
ctatctcgtatctatcccaaaggacaacgtcttgattcatcaaactatgatcccctgcca
atgtggatctgtggcagtcaacttgtagcgctcaacttccagactccagacaaacccatg
caaatgaaccaggctcttttccactccgggggtcgttgcggttatgtttttcagccaagt
agcatgagggatgaaatgttcgatccatttgacaaaggcaccctacgccaggagacaata
accatcagcattgagatcctaggtgcccgccatctgcccaagattggaaggggtattgtc
tgcccttttgtggaggtagaagtttgtggtactgaatatgacaatgcaaagcagaagaca
gaatttgtagtggataatggcttgaatcccatctggccacagaaaaccttcccctttgtc
gttgctaaccccgagtttgctttcctacggtttgtggtctatgaagaggacatgtttagt
gatcagaacttcttggcccaagcctcgtttgtggtccgtggcttgaaaacaggatataga
gccatcccactcaaaaataattacactgaggatctggaactggcatcactgctcattaag
atagacatcaagaccgagaacggagaacttaatggagcttctgcacccagggaacggatc
agtgaccctatgtctgggcgcatttgggatgggccgacagacacgcgatatcattccaac
catctggatgatttccgtgcctcgaacaatttgaaagagaaaggagagtcctcaggaaaa
cgcgtctaa

DBGET integrated database retrieval system