KEGG   Xenopus tropicalis (western clawed frog): 100496686Help
Entry
100496686         CDS       T01011                                 

Gene name
plcg2
Definition
phospholipase C, gamma 2 (phosphatidylinositol-specific)
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100496686 (plcg2)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100496686 (plcg2)
   04370 VEGF signaling pathway
    100496686 (plcg2)
   04020 Calcium signaling pathway
    100496686 (plcg2)
   04070 Phosphatidylinositol signaling system
    100496686 (plcg2)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100496686 (plcg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1259 aa AA seqDB search
MDRRGSSDYRSLPEYEKSQIKRTLELGTVMTVFNYKKSQPDRRTIQVIMETGQVAWCKTN
DKIEGFLDLMEIKEIRPGKNSKDFQRGKCDRCKEDVCFTIFYGNQFVLNTLSLAADSVDD
AEKWKCGLTILLEEVASASTPAIIESWLRKQIYSVDQTRKNSISFRELKTILSQANFKAN
SMRVLKDKLTEIGIQRDDISFEHFHVFYKKLMFEQQKMILDEFRKDSSVFILGNVDRPDG
SAVHLHDFQRFLVHEQQESPAQDLSKVRERMTKFVDDTMRETAEPFLFVDEFLTYLFSKE
NSIWDEKYDTISVQNMNNPLSHYWIASSHNTYLTGDQLRSESSTEAYVRCLRMGCRCIEL
DCWDGPDGKPIIYHGWTRTTKIKFDDVVQAIRDHAFATSEYPVILSIEEHCCVEQQRHMA
KVFKEVLGELLLTKPIEATADQLPSPTQLKGRIIIKHKKLETKNPGTNTENHKEEQNLQG
ELYMWDGIDQKWSSRYCAIAGDKLSYGDEIEQTEDSAAPKRTIDLHLQEKWFHGRMYNGR
FMAEKLLQEYCAEVGGKDGTFLVRQSESYRDDYTLSFWRSGRVQHCRIRSCTDGEIIKYF
LTDNLMFDSIYDLIQHYKEYSLRCAEFELRLTDAVPQPNPHLSKDWYYDNLSRGEAEDML
MRIPRDGAFLIRRREEQDSYAITFRAEGKVKHCRIQRDGRMFVLGTSAYFENLVELVSYY
QKHPLYRKMKLRYPVTEELLQRYSTEKDLSAIYDVKNKLYVNPEEISPAMPQGTVKALYN
YTAVRSDELSFCTGALIHNVSRVSEGWWKGDYGDKIQYFFPSNYVEDISMNASEIIANQL
IEDSPLGSMCRGILEMGSYNIRKLLNGKYNKQFVLSLESKNPEEPTVDFAADTIEEFFVW
YKHIQQIEQKKGAEDFEKGTLEKQQEIARELSDLVMYCKPKSEAKEKLESPDFREIRSFA
ENKGESIARQKSIELLRYNRKAFTRIYPKSSRVDSSNYDPLPLWLCGDQMIALNYQTPDR
YMQINNAMFAYNGECGYILQPECMREESYDPSDSRRQLQMIVTIKVLGARHLPKPGRGIA
CPFVEVEVCGGEYDNNKFRTIVMNDNGLNPVWSGSSQQAEFEIHEPEIAFLRFVVYEEDM
FSDPNFLAQCTIPVKCLKTGYRSVPLKNGYSENLELASLLVYCQIQKDLEKVEELYSSSK
QLRKRQTDLTNELFLYDTHQNMRHPSHEAFVNDSKGNASPEVSNRRLKERQISNSKFYS
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcagggggagttctgattatagaagtctccctgaatatgagaagagccagatt
aagagaacccttgagctgggcacagtcatgactgtcttcaactacaagaagtcacagcct
gatcgaaggaccatccaagtgataatggaaactggccaggtggcgtggtgtaagacaaat
gataagattgaaggattcttggacctaatggaaataaaggaaattcgtccagggaaaaat
tcaaaggattttcaacgtggaaaatgtgaccgttgtaaagaagacgtttgcttcactatt
ttttatgggaaccaatttgttctgaatactttgagtttagcagccgattcagttgacgat
gctgaaaaatggaaatgtggtttaactatcttacttgaagaagttgcttctgcctcaaca
ccagcaataattgaaagttggctgagaaaacagatatactctgtggatcagactagaaag
aacagtattagcttccgggaactgaagaccattctttcacaggccaacttcaaagctaat
agcatgagagtgctgaaggacaagttaacggagattggcattcaaagggatgatattagt
tttgaacattttcacgtattctacaaaaagctcatgtttgaacagcagaagatgatactg
gatgaatttcggaaggattcttcagtgtttattttgggaaatgttgaccgcccagatggg
tcagctgtccacctgcatgattttcaaaggtttctagtgcatgagcaacaggaatcccca
gctcaagatctcagtaaggttcgtgaacggatgacaaaatttgtagatgatactatgagg
gaaacagctgaaccatttctttttgtggacgagttcttgacctacttattttcgaaagaa
aacagcatttgggatgagaaatatgacacgatcagtgttcaaaatatgaataatcctctt
tcacattactggattgcttcctcacataatacgtatttaacaggggaccagctgcggagt
gaatcatctactgaagcatatgtgcgctgtctgcgcatgggatgcaggtgcattgaattg
gactgctgggatggacctgatggaaagccaattatttatcatggatggacacgaacaaca
aaaattaaatttgatgatgtggtacaggctattagggaccatgcatttgctacatctgag
tatccagttatcctttctatagaggaacattgctgtgttgaacaacagagacacatggcc
aaagtttttaaagaagtattaggagagcttcttttgactaaaccaatagaagctactgcc
gatcagttgccttctcccacacaacttaaagggaggatcattattaagcataaaaaactg
gaaacaaagaatcctgggacaaacactgagaatcataaagaagaacaaaatcttcagggt
gagctgtacatgtgggatggtattgaccagaaatggtcttctcgttactgtgctattgct
ggtgataaattatcttatggagatgaaattgaacagactgaagacagcgcagcaccaaag
agaacaatagatttacatctacaagagaaatggttccacgggcgaatgtataatgggcgt
ttcatggcggaaaagctacttcaggagtattgtgcagaagtgggaggcaaagatgggact
ttcttagtacgacaaagtgaatcttatcgtgatgattacacactctctttctggaggtca
ggcagggtccaacactgccgtattcgttcctgtacagatggagaaatcataaagtatttc
ctgaccgacaacctaatgtttgatagtatctatgatttgattcaacactacaaagagtac
tcattgcgctgtgcagaatttgagctgcgactaacagatgctgttcctcaacccaaccct
cacttatccaaagactggtactatgataacctcagcagaggagaggcagaagatatgtta
atgagaatccctcgggatggggcctttttaataagaagaagagaggaacaagattcctat
gcaattacttttagagctgaagggaaagtgaagcactgtagaatacaaagggatggacgc
atgtttgtactaggaacttctgcatactttgaaaaccttgtggaacttgtcagctattac
cagaaacacccgctataccgaaaaatgaaactacgctatccagttacagaagagttactt
cagagatatagcacagaaaaggatttaagtgccatatatgatgtaaagaataaactgtat
gtcaatcctgaagaaatttctccagcaatgccccaaggaacagtgaaagctttgtacaac
tatacagctgtaagatcagatgagctgagcttctgcacaggtgccctgattcataatgtc
tcaagggtctctgaaggatggtggaaaggagattatggagacaagatacagtattttttc
ccctcaaattatgtggaggacatatcaatgaatgcttctgaaataattgcaaatcagctt
attgaagacagtccattggggtccatgtgcagaggtatcctggaaatgggatcatataat
atcaggaagttgcttaatggaaaatataacaaacagtttgttttgtccctggaatccaag
aatccagaagagcctactgtagattttgcagcagatacaatagaagagttttttgtgtgg
tacaaacacatccaacagattgaacagaaaaagggagcagaggactttgaaaagggaaca
ctggagaagcagcaagagattgcccgagaattatctgatctggttatgtactgtaagccc
aaaagtgaagctaaggagaaattagagtcgccggattttcgggaaattcgatcatttgca
gagaataagggagagagtattgctcgacaaaaatccattgagttgttgcggtataaccgt
aaagcctttacgcgaatctaccctaagtcctcaagagttgactcttcaaactatgacccc
ctacccctatggctctgtggagaccagatgattgcactaaattaccagactccagatagg
tacatgcaaataaataatgcaatgttcgcttacaatggagaatgcggctacatcctgcag
ccagagtgtatgagggaagagtcatatgaccccagtgactctagaagacagctccaaatg
attgtgacaattaaggtcttaggagctcgacatttgccaaaaccagggagaggtattgca
tgcccttttgtagaagtggaggtatgcggtggggaatatgacaacaataagttcagaaca
attgttatgaatgataatggcctcaaccctgtatggtcaggaagttctcaacaggctgag
tttgagatccatgagcctgagattgcctttctgaggtttgtagtatatgaagaagatatg
ttcagtgaccccaacttcttagctcagtgcaccatcccagttaaatgtttaaaaacaggt
tatagatcagttccactaaaaaacggttacagtgaaaacctagagcttgcttctctgttg
gtttattgccaaatacaaaaagatctggaaaaagtagaagaactgtactcttcatcaaag
caactccgcaagcgccagacagacctgaccaatgaactgtttctttacgacactcaccaa
aacatgagacaccccagtcatgaggcatttgtgaacgacagtaaagggaatgccagtcca
gaggtgtccaacaggaggttaaaggaaagacagatcagtaacagcaaattctactcataa

DBGET integrated database retrieval system