KEGG   Xenopus tropicalis (western clawed frog): 100496686Help
Entry
100496686         CDS       T01011                                 

Gene name
plcg2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00562  Inositol phosphate metabolism
xtr01100  Metabolic pathways
xtr04012  ErbB signaling pathway
xtr04020  Calcium signaling pathway
xtr04070  Phosphatidylinositol signaling system
xtr04370  VEGF signaling pathway
xtr04625  C-type lectin receptor signaling pathway
xtr04933  AGE-RAGE signaling pathway in diabetic complications
Module
xtr_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100496686 (plcg2)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    100496686 (plcg2)
   04370 VEGF signaling pathway
    100496686 (plcg2)
   04020 Calcium signaling pathway
    100496686 (plcg2)
   04070 Phosphatidylinositol signaling system
    100496686 (plcg2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100496686 (plcg2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100496686 (plcg2)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100496686 (plcg2)
Membrane trafficking [BR:xtr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100496686 (plcg2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100496686 (plcg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 SH3_2 PH_12 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 100496686
NCBI-ProteinID: XP_002934994
Xenbase: XB-GENE-952431
Position
4
AA seq 1259 aa AA seqDB search
MDRRGSSDYRSLPEYEKSQIKRTLELGTVMTVFNYKKSQPDRRTIQVIMETGQVAWCKTN
DKIEGFLDLMEIKEIRPGKNSKDFQRGKCDRCKEDVCFTIFYGNQFVLNTLSLAADSVDD
AEKWKCGLTILLEEVASASTPAIIESWLRKQIYSVDQTRKNSISFRELKTILSQANFKAN
SMRVLKDKLTEIGIQRDDISFEHFHVFYKKLMFEQQKMILDEFRKDSSVFILGNVDRPDG
SAVHLHDFQRFLVHEQQESPAQDLSKVRERMTKFVDDTMRETAEPFLFVDEFLTYLFSKE
NSIWDEKYDTISVQNMNNPLSHYWIASSHNTYLTGDQLRSESSTEAYVRCLRMGCRCIEL
DCWDGPDGKPIIYHGWTRTTKIKFDDVVQAIRDHAFATSEYPVILSIEEHCCVEQQRHMA
KVFKEVLGELLLTKPIEATADQLPSPTQLKGRIIIKHKKLETKNPGTNTENHKEEQNLQG
ELYMWDGIDQKWSSRYCAIAGDKLSYGDEIEQTEDSAAPKRTIDLHLQEKWFHGRMYNGR
FMAEKLLQEYCAEVGGKDGTFLVRQSESYRDDYTLSFWRSGRVQHCRIRSCTDGEIIKYF
LTDNLMFDSIYDLIQHYKEYSLRCAEFELRLTDAVPQPNPHLSKDWYYDNLSRGEAEDML
MRIPRDGAFLIRRREEQDSYAITFRAEGKVKHCRIQRDGRMFVLGTSAYFENLVELVSYY
QKHPLYRKMKLRYPVTEELLQRYSTEKDLSAIYDVKNKLYVNPEEISPAMPQGTVKALYN
YTAVRSDELSFCTGALIHNVSRVSEGWWKGDYGDKIQYFFPSNYVEDISMNASEIIANQL
IEDSPLGSMCRGILEMGSYNIRKLLNGKYNKQFVLSLESKNPEEPTVDFAADTIEEFFVW
YKHIQQIEQKKGAEDFEKGTLEKQQEIARELSDLVMYCKPKSEAKEKLESPDFREIRSFA
ENKGESIARQKSIELLRYNRKAFTRIYPKSSRVDSSNYDPLPLWLCGDQMIALNYQTPDR
YMQINNAMFAYNGECGYILQPECMREESYDPSDSRRQLQMIVTIKVLGARHLPKPGRGIA
CPFVEVEVCGGEYDNNKFRTIVMNDNGLNPVWSGSSQQAEFEIHEPEIAFLRFVVYEEDM
FSDPNFLAQCTIPVKCLKTGYRSVPLKNGYSENLELASLLVYCQIQKDLEKVEELYSSSK
QLRKRQTDLTNELFLYDTHQNMRHPSHEAFVNDSKGNASPEVSNRRLKERQISNSKFYS
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcagggggagttctgattatagaagtctccctgaatatgagaagagccagatt
aagagaacccttgagctgggcacagtcatgactgtcttcaactacaagaagtcacagcct
gatcgaaggaccatccaagtgataatggaaactggccaggtggcgtggtgtaagacaaat
gataagattgaaggattcttggacctaatggaaataaaggaaattcgtccagggaaaaat
tcaaaggattttcaacgtggaaaatgtgaccgttgtaaagaagacgtttgcttcactatt
ttttatgggaaccaatttgttctgaatactttgagtttagcagccgattcagttgacgat
gctgaaaaatggaaatgtggtttaactatcttacttgaagaagttgcttctgcctcaaca
ccagcaataattgaaagttggctgagaaaacagatatactctgtggatcagactagaaag
aacagtattagcttccgggaactgaagaccattctttcacaggccaacttcaaagctaat
agcatgagagtgctgaaggacaagttaacggagattggcattcaaagggatgatattagt
tttgaacattttcacgtattctacaaaaagctcatgtttgaacagcagaagatgatactg
gatgaatttcggaaggattcttcagtgtttattttgggaaatgttgaccgcccagatggg
tcagctgtccacctgcatgattttcaaaggtttctagtgcatgagcaacaggaatcccca
gctcaagatctcagtaaggttcgtgaacggatgacaaaatttgtagatgatactatgagg
gaaacagctgaaccatttctttttgtggacgagttcttgacctacttattttcgaaagaa
aacagcatttgggatgagaaatatgacacgatcagtgttcaaaatatgaataatcctctt
tcacattactggattgcttcctcacataatacgtatttaacaggggaccagctgcggagt
gaatcatctactgaagcatatgtgcgctgtctgcgcatgggatgcaggtgcattgaattg
gactgctgggatggacctgatggaaagccaattatttatcatggatggacacgaacaaca
aaaattaaatttgatgatgtggtacaggctattagggaccatgcatttgctacatctgag
tatccagttatcctttctatagaggaacattgctgtgttgaacaacagagacacatggcc
aaagtttttaaagaagtattaggagagcttcttttgactaaaccaatagaagctactgcc
gatcagttgccttctcccacacaacttaaagggaggatcattattaagcataaaaaactg
gaaacaaagaatcctgggacaaacactgagaatcataaagaagaacaaaatcttcagggt
gagctgtacatgtgggatggtattgaccagaaatggtcttctcgttactgtgctattgct
ggtgataaattatcttatggagatgaaattgaacagactgaagacagcgcagcaccaaag
agaacaatagatttacatctacaagagaaatggttccacgggcgaatgtataatgggcgt
ttcatggcggaaaagctacttcaggagtattgtgcagaagtgggaggcaaagatgggact
ttcttagtacgacaaagtgaatcttatcgtgatgattacacactctctttctggaggtca
ggcagggtccaacactgccgtattcgttcctgtacagatggagaaatcataaagtatttc
ctgaccgacaacctaatgtttgatagtatctatgatttgattcaacactacaaagagtac
tcattgcgctgtgcagaatttgagctgcgactaacagatgctgttcctcaacccaaccct
cacttatccaaagactggtactatgataacctcagcagaggagaggcagaagatatgtta
atgagaatccctcgggatggggcctttttaataagaagaagagaggaacaagattcctat
gcaattacttttagagctgaagggaaagtgaagcactgtagaatacaaagggatggacgc
atgtttgtactaggaacttctgcatactttgaaaaccttgtggaacttgtcagctattac
cagaaacacccgctataccgaaaaatgaaactacgctatccagttacagaagagttactt
cagagatatagcacagaaaaggatttaagtgccatatatgatgtaaagaataaactgtat
gtcaatcctgaagaaatttctccagcaatgccccaaggaacagtgaaagctttgtacaac
tatacagctgtaagatcagatgagctgagcttctgcacaggtgccctgattcataatgtc
tcaagggtctctgaaggatggtggaaaggagattatggagacaagatacagtattttttc
ccctcaaattatgtggaggacatatcaatgaatgcttctgaaataattgcaaatcagctt
attgaagacagtccattggggtccatgtgcagaggtatcctggaaatgggatcatataat
atcaggaagttgcttaatggaaaatataacaaacagtttgttttgtccctggaatccaag
aatccagaagagcctactgtagattttgcagcagatacaatagaagagttttttgtgtgg
tacaaacacatccaacagattgaacagaaaaagggagcagaggactttgaaaagggaaca
ctggagaagcagcaagagattgcccgagaattatctgatctggttatgtactgtaagccc
aaaagtgaagctaaggagaaattagagtcgccggattttcgggaaattcgatcatttgca
gagaataagggagagagtattgctcgacaaaaatccattgagttgttgcggtataaccgt
aaagcctttacgcgaatctaccctaagtcctcaagagttgactcttcaaactatgacccc
ctacccctatggctctgtggagaccagatgattgcactaaattaccagactccagatagg
tacatgcaaataaataatgcaatgttcgcttacaatggagaatgcggctacatcctgcag
ccagagtgtatgagggaagagtcatatgaccccagtgactctagaagacagctccaaatg
attgtgacaattaaggtcttaggagctcgacatttgccaaaaccagggagaggtattgca
tgcccttttgtagaagtggaggtatgcggtggggaatatgacaacaataagttcagaaca
attgttatgaatgataatggcctcaaccctgtatggtcaggaagttctcaacaggctgag
tttgagatccatgagcctgagattgcctttctgaggtttgtagtatatgaagaagatatg
ttcagtgaccccaacttcttagctcagtgcaccatcccagttaaatgtttaaaaacaggt
tatagatcagttccactaaaaaacggttacagtgaaaacctagagcttgcttctctgttg
gtttattgccaaatacaaaaagatctggaaaaagtagaagaactgtactcttcatcaaag
caactccgcaagcgccagacagacctgaccaatgaactgtttctttacgacactcaccaa
aacatgagacaccccagtcatgaggcatttgtgaacgacagtaaagggaatgccagtcca
gaggtgtccaacaggaggttaaaggaaagacagatcagtaacagcaaattctactcataa

DBGET integrated database retrieval system