KEGG   Xenopus tropicalis (western clawed frog): 100496837Help
Entry
100496837         CDS       T01011                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:xtr00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 279 aa AA seqDB search
MTGPSNLQTKAIHVKNTWTRHCNVALFMSSVTDKEFPTIGLGTGEGRDKLYWKTIRAFHY
AHKYYLNETDWFFKGDDDTFVILENMRWMLSNYTADQPIYFGKRFKPYIKQGYMSGGAGY
VLSREALIRFVEGFRTGICTHTTSTEDVAIGNCMQLMGVIAGDSRDTEKRETFHPFSPEG
HITMKFVDSKSFWYWSYCVYPIVEGPQCCSDLAISFHYISPEHMYTLEYLTYHLRAYGYH
YRYQPSLPKNADKLPVYIQNEAVIPNRTVSDFLEPPMGS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactggaccatcaaacctacagaccaaagcaattcatgtgaagaatacatggacccgt
cactgcaatgtagcactattcatgagctccgtcaccgataaagaattccctacaattggc
cttggaactggggaaggcagagacaaactttactggaaaacaatacgtgccttccattac
gcacacaagtactacctgaatgagacagactggttcttcaagggagatgatgatacattt
gtcattttggaaaatatgcgatggatgctttcaaattataccgctgaccaacccatttac
tttgggaagcgcttcaaaccatatatcaagcagggctacatgagtggaggagctggatat
gttcttagcagggaagcccttattcgctttgtagaaggtttccgtactggtatctgcaca
cacacaacctcaacagaagatgttgcaataggtaactgcatgcagctaatgggagtgata
gctggggactcaagggacacagagaaacgagagaccttccatcctttttcccctgaaggc
catatcaccatgaagtttgttgattccaagtcattctggtactggagctactgtgtctat
cctatagtagagggccctcagtgctgctcagatctggccatatcctttcattatattagt
cctgaacacatgtacactttggaatatttaacataccatctccgggcatatggataccat
tatcgttatcaaccgtcattaccaaagaatgcagataagctccctgtttacattcagaat
gaagctgtgatacctaatagaaccgtatctgacttcttagaaccaccaatgggttcataa

DBGET integrated database retrieval system