KEGG   Xenopus tropicalis (western clawed frog): 100497082Help
Entry
100497082         CDS       T01011                                 

Definition
histone H2B 1.1-like
Orthology
K11252  
histone H2B
Organism
xtr  Xenopus tropicalis (western clawed frog)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 126 aa AA seqDB search
MPEPAKSAPAPKKGSKKAVSKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAM
SIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSAK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaacctgccaaatccgccccagcgccaaagaaaggctctaagaaagcggtgagt
aaaacgcagaagaaagatgggaagaagcgcaggaagagcaggaaggagagttacgccatc
tacgtgtacaaagtgctgaagcaggtgcaccctgataccggcatctcttccaaggccatg
agcatcatgaactcctttgttaacgatgtgttcgagcgcatcgcaggggaagcctcccgc
ctggctcattacaacaagcgctccaccatcacctcccgggagatccagaccgcggtccgc
ctgctgctgcctggggagctggccaagcacgctgtgtccgaggggacaaaggctgtgact
aaatacaccagcgccaagtaa

DBGET integrated database retrieval system