KEGG   Xenopus tropicalis (western clawed frog): 100497736Help
Entry
100497736         CDS       T01011                                 

Gene name
prkg2
Definition
protein kinase, cGMP-dependent, type II
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Gap junction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell communication
   04540 Gap junction
    100497736 (prkg2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100497736 (prkg2)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100497736 (prkg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 787 aa AA seqDB search
MGNGSMKSKPLKQPDGQRVNFSISSCNKLRNADTVKNKVWELEIELKKKDEKLKNKEQIF
QELQEQIKKQNQVIEEMAEELQNKCVQLNKLQVVVQTQNGISTTPDLHKMLQPSPTKTLH
ALPTKSLKGSPLKTFSGLFSNSNKRKGAKEGVSAEPTSRYDGGDHPRFSFEKARVRKNTS
EKILISDALNKNQFMKRMDHHQIQDMVECMYERIYLQGEFIIRQGEPGSQIFVLADGKAE
VFQENKLLTSIPVWTTFGELAILYNCTRTASVKAITGVRTWALDREVFQNIMRKTAQSKH
EEYLSFLKSVPLLKELPEHKLMKIADCLELEFYEMDDYIIREGEEGSTFFIISKGKVKVT
QSTEGYKEPQYIKFLEKGDYFGEKALISDDVRSANILAYGDRVECLVMDRETFNKTVGTY
EELMKCLEGYVANLTLDDERRHAKSPVNERHLRAVSMELNKMKQTLARFPSASPFENLEI
VTTLGVGGFGRVELVKVKNENLVFALKCIKKRHIVDNRQQEHIHSEKNILEEACSPFIVK
LYCTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTAKFCTGCVTEAFEYLHQKGVLYR
DLKPENLLLDSEGYVKLVDFGFAKKIFPGQKTWTFCGTPEYVAPEVILNKGHSFSVDFWS
LGILLYELLTGSPPFTGPDQMIIYNLILQGIEKIEFYKNITKRPEDLIRRLCRENPAERL
GNMKNGIADIKKHRWFNGFNWEGLNTRSLPSPLKPELEGPTDHSYFDSYPPDEEIPPDEV
SGWDQDF
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggctctatgaaatccaaaccacttaagcagccagatggacaacgggtgaac
ttctccatcagctcctgcaacaagctccgtaatgcagacactgtaaaaaataaagtctgg
gaattagagatagaacttaagaaaaaagatgagaagctgaagaacaaagaacaaatattt
caagagctgcaggaacaaattaagaagcaaaatcaggttattgaagagatggcagaagaa
cttcaaaacaaatgtgttcaacttaacaaactgcaagttgttgtacaaactcagaatggt
atctccacaactccagacctgcataaaatgttacagccctctccaacaaaaacccttcat
gctttaccaactaaatcattgaagggatccccacttaaaaccttttcaggcctgttcagc
aacagcaacaagagaaaaggggcaaaggaaggagtttctgcagaacctaccagcagatat
gatggaggtgatcatccaagattctcatttgaaaaagcacgtgttaggaaaaatacaagt
gagaagattcttatatcagatgctttaaacaagaaccagtttatgaagagaatggatcat
catcaaattcaagacatggtagaatgcatgtatgaaagaatatatcttcaaggtgaattt
attatcagacaaggggaaccaggaagccagatctttgtattagcagatggaaaagcagaa
gtttttcaggagaacaaacttctgacatccatcccagtctggacaacatttggggagctt
gcaatattgtacaactgcacaagaacagcctctgtgaaagcaatcaccggtgtcagaaca
tgggctctagaccgcgaagtgtttcagaatataatgagaaagacagcccaaagtaaacat
gaagaatacctaagttttcttaagagtgtgcccttgttgaaggaacttcctgaacataag
ctaatgaagattgcagattgcttggaactggaattctatgaaatggatgattacattatt
cgtgaaggagaagaagggagcacattcttcataatttctaaaggaaaggtgaaagtgacc
cagagcacagagggttataaagaacctcagtatataaaatttttggaaaaaggagattac
tttggtgaaaaagctcttatcagtgatgatgtcagatcagcaaatatactagcatatgga
gatagagtggagtgtcttgtcatggatcgagagacatttaataagacagttggaacgtac
gaagaacttatgaaatgtcttgagggatatgtagcaaatttgacccttgatgatgaaaga
aggcatgccaagagcccagtgaatgaacgacatctaagagccgtgtcaatggaactgaat
aaaatgaaacaaactcttgcaagatttccatctgcatccccttttgagaatctagagatt
gtcacaacactgggtgtcggtgggttcgggagagtggaacttgtcaaggtaaagaatgag
aatctggtttttgcactaaaatgcattaagaagaggcacattgtggacaacaggcaacaa
gagcatatacattctgaaaaaaacattttagaagaagcatgctctccttttattgtgaaa
ctctactgcactttcaaggataataagtatgtgtatatgcttcttgaagcatgccttgga
ggggagctttggagcattttaagagataggggcagttttgatgagcctactgcaaaattc
tgcactgggtgtgtaacagaggcttttgagtatttgcatcaaaaaggggttctatatcgg
gatttgaagccagaaaacttacttctggattcagaaggctatgtcaaactggttgatttt
ggatttgctaagaaaattttccctgggcaaaaaacatggacattttgtggcacgccagaa
tatgttgctccagaagttattttaaacaaaggacatagcttcagtgtggatttctggtca
ctaggaatattattgtatgaactcctgacaggaagccctccttttactggacctgaccag
atgatcatctacaatttaattcttcaaggaattgaaaaaatagaattttacaaaaatata
acaaaacgccctgaagatttgattcgccgcctctgtagggagaatccagcagaacgactt
ggaaatatgaagaatggcatagctgatattaaaaagcacaggtggtttaatggctttaac
tgggaaggattaaatactaggagtctgccttctcctttaaaacctgagctagaaggcccc
acagatcatagttattttgacagctacccaccagatgaagaaatccctccagatgaggtg
tcaggatgggatcaagacttctga

DBGET integrated database retrieval system