KEGG   Xenopus tropicalis (western clawed frog): 100497838Help
Entry
100497838         CDS       T01011                                 

Gene name
pdk1, PDKo1, PDKo3, xPDKo1, xPDKo3
Definition
(RefSeq) pyruvate dehydrogenase kinase 1
  KO
K12077  pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100497838 (pdk1)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: Other
  PDHK family [OT]
   100497838 (pdk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BCDHK_Adom3 HATPase_c HATPase_c_3
Motif
Other DBs
NCBI-GeneID: 100497838
NCBI-ProteinID: XP_002934664
Xenbase: XB-GENE-483609
Position
9
AA seq 412 aa AA seqDB search
MRLLRALMRSAPLASSNTPSLVDFYSKFSPSPLSMKQFLDFGSVNACEKTSFIFLRHELP
VRLANIMKEINLLPDNLLKMPSIKLVQSWYVQSFQEIIDFKDNNAEDPDTVRKFSDTVIT
IRNRHNDVIPTMAQGVVEYKDSFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHTLLFGG
KVKVNPAHPKHIGSIDPACNVVDVVKDGYENAKHLCDLYYMSSPEVELTEFNAKSPGQPI
QVVYVPSHLYHMVFELFKNAMRATMEFHADKGVYPSVKVHVVLGSEDLTIKLSDRGGGVP
LRKIDRLFNYMYSTAPLPRMETSRATPLAGFGYGLPISRLYAKYFQGDLKLYSLEGYGTD
AVIYFKALSTESIERLPVYNKSAWKHYKTNHEADDWCVPSSEPKDMTTFRSN
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctcagggctctgatgagaagcgcccccttggccagcagcaatacccccagc
ctggtggacttctactccaagttttccccgtccccattgtccatgaaacagttcctggat
ttcggctcagtcaatgcgtgtgaaaagacatcatttatatttctgaggcatgaattgcca
gtacggttagcaaacatcatgaaagagatcaatttgctgccagacaatctcctgaagatg
ccatccattaagctggttcagagctggtacgttcagagcttccaagaaataattgatttt
aaggacaacaatgctgaagacccagatacagtccgaaaattctcagatacagtgatcacc
atcaggaaccggcacaacgatgtcatcccgactatggctcagggagtggtagaatacaaa
gacagttttggggtcgaccctgtcacttctcagaatgtgcagtattttttagaccgtttt
tacatgagtcgcatatccattcgaatgctgctgaaccaacacactctgctgtttggaggg
aaggtgaaagtgaatccagcacacccgaagcacatcggcagcattgacccagcatgcaac
gttgttgacgtagttaaagatggatatgaaaatgcaaaacatttgtgtgatttgtattac
atgagctccccggaagtagagctaacagagttcaatgctaaatctccaggacagcccatt
caagtggtttatgtgccatctcatctctaccacatggtgtttgaacttttcaagaatgca
atgagagccaccatggaattccatgcagacaaaggagtctatccttccgtcaaagtgcat
gtggttttaggcagtgaggatttaacaataaagctcagtgaccgaggaggtggggttccg
ctaaggaaaatagaccgtttgtttaactacatgtattctactgcaccactgcctcgaatg
gagacatctcgtgcaaccccattggctgggtttggatatggcttgccaatatctcgcctc
tatgcaaagtattttcaaggagatttgaagttatattccctggagggatatgggacggat
gctgttatatactttaaggctttatcaacagagtcgatagagaggctccccgtgtacaat
aaatctgcctggaaacattataagaccaaccacgaagcagacgactggtgcgtcccaagc
agcgagcccaaggacatgaccacctttcgcagcaactga

DBGET integrated database retrieval system