KEGG   Xenopus tropicalis (western clawed frog): 100497838Help
Entry
100497838         CDS       T01011                                 

Gene name
pdk1
Definition
pyruvate dehydrogenase kinase, isozyme 1
Orthology
K12077  
pyruvate dehydrogenase kinase isoform 1 [EC:2.7.11.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100497838 (pdk1)
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100497838 (pdk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 412 aa AA seqDB search
MRLLRALMRSAPLASSNTPSLVDFYSKFSPSPLSMKQFLDFGSVNACEKTSFIFLRHELP
VRLANIMKEINLLPDNLLKMPSIKLVQSWYVQSFQEIIDFKDNNAEDPDTVRKFSDTVIT
IRNRHNDVIPTMAQGVVEYKDSFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHTLLFGG
KVKVNPAHPKHIGSIDPACNVVDVVKDGYENAKHLCDLYYMSSPEVELTEFNAKSPGQPI
QVVYVPSHLYHMVFELFKNAMRATMEFHADKGVYPSVKVHVVLGSEDLTIKLSDRGGGVP
LRKIDRLFNYMYSTAPLPRMETSRATPLAGFGYGLPISRLYAKYFQGDLKLYSLEGYGTD
AVIYFKALSTESIERLPVYNKSAWKHYKTNHEADDWCVPSSEPKDMTTFRSN
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgctcagggctctgatgagaagcgcccccttggccagcagcaatacccccagc
ctggtggacttctactccaagttttccccgtccccattgtccatgaaacagttcctggat
ttcggctcagtcaatgcgtgtgaaaagacatcatttatatttctgaggcatgaattgcca
gtacggttagcaaacatcatgaaagagatcaatttgctgccagacaatctcctgaagatg
ccatccattaagctggttcagagctggtacgttcagagcttccaagaaataattgatttt
aaggacaacaatgctgaagacccagatacagtccgaaaattctcagatacagtgatcacc
atcaggaaccggcacaacgatgtcatcccgactatggctcagggagtggtagaatacaaa
gacagttttggggtcgaccctgtcacttctcagaatgtgcagtattttttagaccgtttt
tacatgagtcgcatatccattcgaatgctgctgaaccaacacactctgctgtttggaggg
aaggtgaaagtgaatccagcacacccgaagcacatcggcagcattgacccagcatgcaac
gttgttgacgtagttaaagatggatatgaaaatgcaaaacatttgtgtgatttgtattac
atgagctccccggaagtagagctaacagagttcaatgctaaatctccaggacagcccatt
caagtggtttatgtgccatctcatctctaccacatggtgtttgaacttttcaagaatgca
atgagagccaccatggaattccatgcagacaaaggagtctatccttccgtcaaagtgcat
gtggttttaggcagtgaggatttaacaataaagctcagtgaccgaggaggtggggttccg
ctaaggaaaatagaccgtttgtttaactacatgtattctactgcaccactgcctcgaatg
gagacatctcgtgcaaccccattggctgggtttggatatggcttgccaatatctcgcctc
tatgcaaagtattttcaaggagatttgaagttatattccctggagggatatgggacggat
gctgttatatactttaaggctttatcaacagagtcgatagagaggctccccgtgtacaat
aaatctgcctggaaacattataagaccaaccacgaagcagacgactggtgcgtcccaagc
agcgagcccaaggacatgaccacctttcgcagcaactga

DBGET integrated database retrieval system