KEGG   Xenopus tropicalis (western clawed frog): 100497993Help
Entry
100497993         CDS       T01011                                 

Gene name
plcd3
Definition
(RefSeq) phospholipase C, delta 3
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100497993 (plcd3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100497993 (plcd3)
   04070 Phosphatidylinositol signaling system
    100497993 (plcd3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100497993 (plcd3)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100497993 (plcd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 747 aa AA seqDB search
MPGVFGTVCGGRKKKKKYKPESEVLEQEVQPVSSQGLKTFKKMGLSGDDDVNAMLCGSNL
WKIRPGWHAARLYRLESDGMTVWYESQAKKARSKQIFSVLHIESVREGHQSEGLQKYGRR
FPETCCFTIAFKGRRKNLDLAASSEKEALNWVQGLQKLMKRAEAMSQREKLVHWIWDYLR
QADRDGDEKMTFQEVKDMLKMINIDLNDIYAYNLFKACDRSNTNTLEDHEIEEFCTKLMH
RPEVEEIFHHYSGEDRVLSAEELQEFLQAQGEDATLERAKELIQKYELNETAKQHDLMMM
EGFMMYLLSDDGDIFNQKHRMAYQDMTQPLCHYFISSSHNTYLTNHQLVGESSTESYIRV
FMEGCRCVELDCWEGPSGEPVIYHGHTLTSKILFKDVVTTIRDYAFKNSPYPVILSLENH
CGLEQQVKMANHLREILGDMLVTKPVPGADTARLPSPEALKGKFLLKGKKLNNRKSVEEE
EGKPRMDTAKELSDLVVYCQTVEYQGQPGNVCEMSSFSEDKVRRLIKDSGINLVRYNARQ
LSRIYPDGLRANSSNYCPQEMWNAGCQLVALNFQTPGYTMDLNRGRFQDNGLCGYVLKPE
FLRKEDSYFNPDSPSKEPKLLFVKVISAQQLPKLNKEKPNSIVDPFVRVEIHGVGKKKEK
ETKYILNNGFNPYWNEILQLEVQVPELALVRFVVEDYDKTSSNDFVGQYTLPFLSLKQGY
RHVHLLSKDGASLSPATLFVQIRIEDL
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcgtatttggcaccgtgtgtgggggcagaaagaagaagaagaagtacaagcca
gaatctgaagtgttggaacaagaagtacagcccgtcagtagtcagggactcaaaaccttc
aagaaaatgggcctgtcaggtgacgatgatgtgaacgccatgctttgtggttccaacctc
tggaagatcaggcctggatggcatgcagccagattataccgcctggaatctgatggaatg
accgtctggtacgagagccaagctaagaaggcacgctccaaacagatcttctccgtcctg
cacattgaatccgtacgggaaggccatcagtccgaagggctacaaaaatatggccgccgc
tttcctgagacatgctgctttaccattgccttcaaggggaggagaaaaaacttggatctt
gcagcatcttccgaaaaggaggctctgaactgggtgcaggggttacagaagctcatgaaa
cgggccgaggcaatgagccagagggagaaattagttcactggatatgggattatctccgc
caagctgacagagatggagatgaaaagatgacattccaagaagtgaaggatatgctgaag
atgataaacattgacttgaatgatatctatgcttacaaccttttcaaggcctgtgaccgc
tccaatacaaacacactggaggaccatgagatagaggagttctgcactaagctcatgcac
cgccctgaggtggaggaaatattccatcattactcaggagaggatcgggtactgtctgct
gaggaactgcaggaattcctgcaagcgcagggggaagatgccacgctggagagggcaaag
gagcttattcaaaaatatgagctcaatgagacagccaagcagcatgatctgatgatgatg
gaagggttcatgatgtacctgttgtcagatgatggagatatcttcaatcagaagcatagg
atggcgtaccaggacatgacccagccattgtgccactacttcatctccagctcccacaat
acgtacctgaccaaccaccaactggtgggagaaagcagcacagagtcgtacatcagagta
ttcatggaaggctgccgttgtgtggaactggactgctgggaggggccgtcgggagaacca
gtcatttaccacggacacacgctgacctcaaaaatcctctttaaagatgtggtgaccact
ataagagactatgctttcaaaaattccccctatcctgtaatcctgtccctggagaatcac
tgtggcttggagcagcaagtgaaaatggcgaaccatctacgtgagatcctgggagacatg
cttgtgactaagcctgtgcctggtgcagacaccgctcggcttccttctccagaggcatta
aagggcaagtttttactcaaggggaagaaattaaataatcgcaagtctgtagaggaagag
gaaggaaaaccccgaatggatacagccaaagagctctcagacctggtggtatactgtcag
actgtggagtatcagggacagccgggaaatgtgtgtgagatgagttccttcagtgaagac
aaagtgcgcagattgataaaagactcaggaatcaatctagtgcgctataatgcccggcaa
ctgagtcgcatctacccagatggtctgcgggcaaactcttctaattactgcccccaggag
atgtggaacgcaggctgccagcttgtggctctgaatttccaaacaccgggctacacgatg
gatttaaatcgaggtcgattccaggacaatggactctgcggatatgtcctaaagcctgaa
ttcctgagaaaagaggatagttactttaacccagattctccaagcaaagagccaaagctc
ctttttgtcaaggtcatttcagctcagcagctgccaaaactcaacaaggagaagcccaac
tctattgtagatccatttgtacgtgtggaaattcatggagtggggaaaaagaaagaaaag
gaaactaaatacatcctcaataatggttttaacccttactggaatgagatacttcaacta
gaagttcaagtcccagagttggctcttgttaggtttgtagtggaagactatgacaaaacg
tcgagtaatgattttgttggacaatacacattacctttcctcagcctaaagcaaggatac
cgccatgttcacctgttgtccaaggatggagcctcactgtcccctgctacattgtttgtg
caaatccgtatcgaggacttgtaa

DBGET integrated database retrieval system