KEGG   Xenopus tropicalis (western clawed frog): 100498202Help
Entry
100498202         CDS       T01011                                 

Definition
mitogen-activated protein kinase 4-like
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100498202
Protein kinases [BR:xtr01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   100498202
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 577 aa AA seqDB search
MAEKCEYIANMYGYDLGCHFVDFKPLGFGANGLVLSAVDSKNSRRVAVKKIAISDGRSMK
HALREIKIIRRLNHDNIVKVHAVLGPRGADLQGDILKYNLVYIVQEHMETDLAQLLEQGP
LTEDHAKLFMYQLLRGLKYIHSTNVLHRDLKPANIFISTEELLLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGSHELEQMQL
ILDTIPVIHEEDKEELLKVMPSFINASWEVRKPLRKLLPEMNSEAIDFLEKILTFNPMDR
LTAEAALQHPYMSPYSCPEDEPISQHPFRIEDEIDDILLMEASQSQLSNWDRYQVSLSSD
MDWRSDLSRGMSDVQRDPRAGSELQVEEAQVDPRKYSQSSSERFLEQSHSSMDRVFEGES
FEYKVGSPSYLDKLLWRDNKPHHYSEPKLIMDLSNWKRTTIPPAEDLSLQEEPSNLFLEI
AQWVKSTQVGLECPSNPPSETQQHDPPCSPRHELPPSSISKDAESQFDLDVFITRALKLC
TSPEDIADNKMADLNGACISEHPNDIVPKETFHKDRW
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagtgtgagtatattgccaacatgtatggctacgatttgggctgccatttt
gtggattttaagccgttggggtttggggccaatggtttagttctgtcagctgtcgacagc
aagaactcgagaagggtggctgtgaaaaagattgccatcagcgatgggcgaagcatgaag
cacgccttgagggaaattaagattatccggcgtctgaaccatgacaacattgtaaaagtc
catgcagtcctgggtccgagaggagctgacttacaaggagatatattaaagtacaacttg
gtgtatattgtgcaggagcatatggagaccgacctcgcccagctgctggaacaaggtccc
cttactgaagaccacgctaagctgttcatgtaccagctcctccgagggctcaagtacatt
cactcaaccaacgtgcttcacagggatttaaagccggccaatatattcatcagtactgag
gaactgctgctcaagattggggattttggattggccaggattgtggaccaacattactca
cataagggctatctctctgaagggctggtaacgaaatggtatcgatccccacggcttctg
ctgtcccctaacaactatactaaggctattgatatgtgggcggcggggtgcatactggca
gagatgctcacagggagaatgctgtttgcagggagccatgaattggagcagatgcagctg
atattggacaccatccctgtgattcatgaggaggataaggaggagctgctcaaggtcatg
ccatccttcataaacgcctcctgggaggtccggaaacccctgcgaaagctgctccctgag
atgaactcggaggcgatcgatttcttggaaaagatactaaccttcaacccgatggaccgg
ttaaccgccgaagctgctctacagcatccctacatgagcccctactcctgccccgaggat
gagcccatatcccaacatccgttccggattgaggatgaaattgatgacattttgctcatg
gaagccagtcagagccaactctctaactgggacaggtatcaagtcagcctgtcttctgac
atggactggaggtctgacctgagccgcgggatgagcgacgtccaacgagacccccgagcc
ggatctgaactgcaagtagaagaagcccaagtggacccgcgcaagtattcccagagcagc
tccgagaggttcctggaacaatcccactcgtccatggatcgggttttcgagggagagtcc
tttgaatacaaagtggggtccccttcctacctggacaagctgctctggagagacaacaag
ccccaccactactcggaacccaagctaattatggatctctccaactggaaaagaaccaca
atcccacccgctgaggacttatcgctgcaggaggagccatccaacctgtttctggagatc
gctcagtgggtgaagagcacccaggttggccttgagtgtccgtccaacccaccctcagag
acacaacaacacgacccaccttgctcccctagacacgagttgccgccgagtagtatcagc
aaagacgccgagtctcagtttgacctcgatgtttttattacccgggcgttaaagttatgt
acaagcccagaagacatagcggacaataaaatggctgatctcaatggcgcttgtatctca
gagcacccgaatgacattgtgccaaaggaaacatttcacaaagaccgatggtag

DBGET integrated database retrieval system