KEGG   Xenopus tropicalis (western clawed frog): 100498395Help
Entry
100498395         CDS       T01011                                 

Gene name
usp13
Definition
ubiquitin specific peptidase 13 (isopeptidase T-3)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100498395 (usp13)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100498395 (usp13)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100498395 (usp13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 844 aa AA seqDB search
MAEDLGELLVPYMPTIRVPKSGDRVYKTECAFSYDSPESDGGLYVCMSTFLGFGREHVER
HYRKTGQSVYMHLKRHIRLKATGASGGAFPKRINGRLFLDLENNTEMNTEDYEYEDEAKL
VIFPDHFEIALPNIEELPALVTIACDAVLNSKSPYRKLDQESWEEELQVSKFANNLVQID
NGVKIPPSGWKCSKCDLQENLWLNLTDGSIMCGRWFCSGSGGNGHALEHHKQMGYPLAVR
LGSITPDGADVYSFDEEEAVIDPHLAKHLAHFGIDMLQMQGSENGVLDNEVKPRVNEWEV
IQETGLKLKPMFGSGYTGIKNLGNSSYLTTVMQVIFSIPEFQRAYVGNLTRIFDYAPLDP
TQDFSTQMAKLGHGLLSGQFSKPPMKSELIEQVMKEEHKPQPKGINTRMFKALMSKGHTE
FSSNRQQDAEEFFLHFINLVERNSIGAENPSDVFRFLVEERTQCCQSRKVRYTERVDYIM
QLPVPMETATNKEELIAYDLKRREAESAKRPPPELVRAKIPFSACLQAFTEPENVPDFWS
SALQAKSAGVKTSRFASFPEYLVVQIKKFTFGLDWVPKKLDVSIDMPDLLDINHLRATGL
KSGEEELPDIAPPIIIPDDPNDHSRNHFMEYPDIDESSVMQLAEMGFPLEACRKAVYYTG
SMGAEVAFNWIIAHMEEPDFAEPLIIPGCGTVTSTSSHGQNALLNQPPEEIVALICSMGF
PRNHALQALRATNNNLERALDWMFSHPESEEGADNVSGCVDTENNPNGIITDSEQEGPRI
KDGNGRYELFGIISHAGTSTMSGHYVCHIKKEGRWVIYNDHKVSASERPPKELGYIYFYH
RISC
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagacctgggagagctgctggtcccttacatgcccaccatcagggtacccaag
tcaggggacagggtctacaagacggagtgcgccttctcttatgactcccctgagtctgat
ggaggtctgtatgtgtgcatgagcacattccttggatttggcagagaacatgtagagcgg
cattataggaaaacagggcagtcagtctacatgcacttaaagcgccacatcagactgaaa
gcaactggcgcatcaggcggggcctttccaaaaagaataaatgggagactatttttagat
ctagaaaataacaccgagatgaacactgaagattatgaatacgaagatgaagcaaaactt
gttatattcccagatcactttgaaattgccttacctaatatagaagagctacccgcattg
gtaacaatagcctgtgatgcagtcctcaattcaaagtctccatatagaaagcttgaccaa
gaatcatgggaagaagaactccaggtttcaaagtttgcaaacaaccttgtgcaaatagat
aatggtgtgaagattccaccaagtggctggaagtgctccaagtgtgatctccaagagaac
ctgtggttgaacttgacagatggctccattatgtgtggaaggtggttttgttcaggcagt
ggtgggaacggacacgctcttgaacaccataagcaaatgggctaccctttggcagtaaga
ctaggaagtatcactccagatggggcagatgtgtattcctttgatgaagaggaagcagtt
atagatccccacctggccaagcaccttgcgcactttggcattgatatgctgcagatgcag
ggaagtgagaatggtgtcctggacaatgaagtcaaaccaagagttaatgagtgggaggtt
atccaagaaactggattaaagttaaagccaatgtttggctctggctacactggcattaaa
aaccttgggaacagctcctacctcactacagtgatgcaagtcatctttagcatccctgag
tttcagagagcatatgtggggaaccttacacgaatatttgattatgcacctctggaccca
acacaggatttcagcacacagatggctaaacttggccatggtctgctgtcaggacagttc
tccaaacctccaatgaaatctgagctaatcgagcaggtgatgaaagaagaacacaagcct
caaccaaagggcattaacactcgaatgtttaaagctttaatgagcaaaggtcatacagaa
ttttcctcgaacagacaacaagatgcagaagaattttttctacactttataaacctggta
gagagaaatagtataggcgcggagaacccaagtgatgtcttcaggtttttagtggaggaa
aggacacagtgctgccagtcaaggaaagtgcgttatactgaaagagttgactacatcatg
caactgccagtgcccatggaaactgctacaaataaagaggaactgattgcatatgacctg
aaaagaagagaagcagagagtgcaaagaggcctccaccggagctggtccgtgccaagatc
ccattcagtgcctgcttacaggcctttacagagcctgaaaatgtgcctgacttctggagc
agtgctcttcaagccaagtctgcgggtgttaagacatctcgctttgcttcattccctgaa
tacctggtagtccagataaagaagtttacatttggccttgattgggtacccaagaaactt
gatgtgagtatagacatgccagatcttcttgacatcaaccatctcagagctacagggctc
aaatcaggagaagaggaacttccagatattgctcctcctattatcattcctgatgatccc
aacgatcattccaggaaccactttatggaatatcctgacatagatgaatcttcagtgatg
cagttggcagaaatgggctttcctcttgaagcctgccggaaagcagtgtattacacaggg
agcatgggggcagaagtggcatttaactggattattgcgcacatggaagaaccagatttt
gcagaaccgttaatcattcctggttgtggaacagtgacctctacatcatctcatgggcag
aatgcgctattaaaccagccaccagaagagattgtagcacttatttgctctatgggtttc
ccaagaaatcatgctctccaggcactaagagccacaaacaataatcttgaaagagctctg
gactggatgttctctcacccagagagtgaagaaggagctgataatgtctctggctgtgtg
gatacagagaacaatcccaatggcattatcactgacagtgaacaggaaggccctagaata
aaggatggcaatggaagatatgaactctttggaattatcagtcatgcaggaacatctaca
atgtcgggacattatgtctgccatatcaaaaaggaaggaagatgggtgatttataatgac
cataaagtttctgcatcagagcgacctccaaaggaattgggctacatttacttctatcat
agaatatcatgttaa

DBGET integrated database retrieval system