KEGG   Xenopus tropicalis (western clawed frog): 100498399Help
Entry
100498399         CDS       T01011                                 

Definition
catechol O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:xtr00140]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:xtr00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 259 aa AA seqDB search
MLQVLLAVGMGALALLLFVVWRVRTDGAWALWWHDNYLERLRDFTSGQSRPMRILQFVQS
AAAPGDANSAICAVDSYCANVEWAMNVGDKKGQILDAVVLAVRPRWVLELGTYCGYSTMR
IARLLPPGARLVTLEMNQHYAQVAKQILGHAGLDTQVDLLVGASSALIPQLKKKFEMETF
DLIFIDHWKASYLPDARLLEECGLLAPGTVLLADNVTCPGAPDYLQYVRNSPRYRSEYFP
CQLEYLQVEDGMEKSVFLG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggtgttgctagcagtgggcatgggagccctggcactgctcctgttcgtggta
tggcgggttcgtacagatggcgcgtgggcactctggtggcacgataattacctggagcga
ctgcgagacttcaccagcgggcagagccggcccatgcggatcctgcagtttgtacagagc
gcagcggcgccgggagatgccaacagcgccatttgtgccgtggattcctactgtgccaat
gtagagtgggcaatgaacgtgggggacaagaaagggcagattctggacgcggtggtgctg
gctgttcgccctcgctgggtcctggaactgggcacatactgtggttattccaccatgaga
attgcccgactcctgcccccaggggcccggcttgttaccctcgagatgaaccaacactat
gcgcaggtggccaagcaaatcctcgggcacgcggggctggatacccaggtggatctgctg
gtcggtgccagttctgccctcatcccgcagctgaagaagaagtttgagatggaaacgttt
gatctgatctttatcgaccactggaaggcgagttacctgcccgatgcccggctgctggag
gaatgcggtttgctggcgcctggcaccgtcctattggccgataacgttacctgccccgga
gcccccgactacctacagtacgtgagaaacagcccccgctatcggagcgagtacttcccg
tgccagctggagtacctgcaggtggaggatggcatggagaagtcggtgttcctgggctga

DBGET integrated database retrieval system