KEGG   Xenopus tropicalis (western clawed frog): 100498415Help
Entry
100498415         CDS       T01011                                 

Definition
protein-glutamine gamma-glutamyltransferase E-like
Orthology
K05620  
transglutaminase 3 [EC:2.3.2.13]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100498415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 703 aa AA seqDB search
MTSLVLKSIDLQQKSNAAAHNTSDYVSKVPIVRRGLPMKVTLAFSRALQSTESLALVMET
GPSPSASTNTRIVMPVSSSRRNDTWSATLESSSAGTMTVSINIPVNASIGPYKITAQITS
AGRTSTNDVGRCSVLFNAWASGDEAYMSNDAERKEYVLNETGLVFYGSAGFPSSSAWDYG
HFEDGVVDICFKLLQESPEYKADPATHISKCNDPVYISRILSAMVNSQDDRGVIVGNWSG
DYSGGENPSSWSGSVALLQRWSQSGPVRYGQCWVYAGVLCTTLRCLGLAARLITNFESAH
DTNNNLIIEQYLDAYGRSIGSPDSVWNFHAWVECWFRRKDLGSTYDGWQILDATPQEPSG
GSYRLGPTSQKAVKLGDVNLPFDGPFVLAEVNADEIYYGRRNDGTFSILYTDTRKVGQYI
STKAVGNFSRQDVTDQYKFPEGSKEERDSLHKAQGLTARSDRVMLASRRLNATAARVVED
KPPIQEAPKPEIFGTFKLSGELQVGQDFTVTLNLKNPTSSKKQVNAKWTLTAIVYNRTPV
KEILSDSQSVTLAPNEEKVIEITVLYPQYEKALTPDNMIRASAVCVEENGGSLLVDKVIT
LKNPPLQITAPERVTWGKSATLGIVFTNPISEDIKNCVVTLQGSGILKKTLKVPLPDLKA
NQRIRAEAEVTPYRNGKRVVIAGFSCDKFSDVKGYQTVDVMAA
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccttgtgctgaaaagcattgatcttcaacaaaaatccaacgcggctgcccat
aataccagtgactatgtctccaaagtccccattgtgagaagaggtctgcctatgaaggtg
acattggcattcagtcgagctttacagagcacagagagtctggctttggtcatggagaca
ggtccctctccttcagcaagcacaaacacaaggattgtaatgccagtatcaagttctcgg
cgtaatgatacctggagtgccacccttgaatcaagcagcgctggaaccatgactgtttcc
attaatattcctgtcaacgctagcattggaccttacaagattactgcacaaattacaagt
gcagggcgcacaagcactaatgatgttggaagatgtagtgtcctatttaatgcttgggca
tcaggtgatgaggcatacatgagtaacgatgcagaaagaaaggaatatgtactcaatgaa
actggactagtattctatggaagtgcaggtttcccatcaagctcagcgtgggactatggc
cattttgaagatggagtagtggacatatgcttcaagttgctacaagagagtccagaatac
aaagcagaccccgctacacatatctcaaaatgtaatgaccctgtctatatctcaaggata
ttaagtgctatggttaatagccaagatgacaggggtgtaatagtggggaactggagcggc
gattactctggcggtgaaaaccccagctcttggagtggaagtgttgccctccttcaaagg
tggagccaaagtggacctgttagatatggacagtgctgggtttatgctggagtactctgt
acaacactccgatgcctggggttagctgcccgtttgataacaaactttgagtcagctcat
gacaccaataacaatctaattattgagcagtatttggatgcatatggaagaagtatagga
tctcctgacagcgtgtggaatttccatgcttgggttgaatgttggtttaggagaaaagat
ctcggttcaacatatgatggatggcagattctggatgcaaccccacaggaaccaagtgga
ggcagctatcgccttgggccgacttcacaaaaagctgtaaaactgggcgatgtgaacctg
cccttcgatggaccatttgtgcttgctgaagttaatgcagatgaaatctactatggcaga
aggaacgatggaacattttccattctttacaccgatactcgaaaggttgggcaatatatc
tctaccaaagcagttggaaatttctcccgtcaagatgttacagatcagtacaaatttcca
gaagggtccaaagaagaaagggattctcttcataaagctcagggattaacggcaagatca
gatagagtcatgcttgccagcaggagactgaatgcaacagcagcacgtgtagtagaagat
aagccacccatccaggaagcaccaaaacctgaaatctttggtaccttcaagctgagtggg
gagctgcaggttgggcaagacttcacagtcactctaaatctaaaaaatccaacgtctagc
aaaaagcaagtgaatgccaaatggactcttacagcaattgtatataacagaactccagtg
aaagaaatactaagtgattcccagtcggtcacattggctcctaatgaagagaaagttata
gagatcacagtcctgtatcctcagtacgaaaaagccttaacgcctgacaacatgattcga
gccagcgcagtgtgtgttgaagaaaatggaggaagtttgttagttgataaagttatcacc
ttgaaaaatccacctctccagataacggcccccgaacgtgttacttggggcaaaagtgcc
actctggggatcgttttcacaaacccgatttcagaagatataaaaaactgtgtggtcaca
ttacagggcagcggcatcctgaagaaaactctgaaagtccctttgccagatctgaaagcc
aatcagagaataagagccgaagctgaagtgaccccataccgaaacggtaaaagagttgtc
attgctggcttctcctgtgacaagttctctgatgtaaagggttaccagactgttgatgtg
atggcagcttag

DBGET integrated database retrieval system