KEGG   Xenopus tropicalis (western clawed frog): 100498476Help
Entry
100498476         CDS       T01011                                 

Gene name
usp35, usp38
Definition
ubiquitin specific peptidase 35
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100498476 (usp35)
Peptidases [BR:xtr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100498476 (usp35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 997 aa AA seqDB search
MDKILEAVMQSSYPMHVKQSLARRVIEASKQPVDSEQCWSMLELSTKLFFLGESHFSRET
AREVLEVYGRYHPEEFEEFFNARFILSLLQEGYGVLGKRSTHILDYVHLGLKFVSDKPSA
EDIFRLLRIEVLRMVCERPGLKLCVRISNLLVSYPQCIPAGKHQVLFCQQLIRSIGQFHC
SSQAEEYIVQFLDQVNRVCGLLQKIWSFQTSLVLPCLKELFAIISSTDEYEAPSNCLASV
VQYIPLELMEGVVKNLANADSVSDIQIMAAISRMIDWVSWPLGKNIDKWIIALLKALAAV
KKFSILIEVSLSKIQKVFSKLVYPVLRDGALSVLRYMLLSFQHSPEAFHLIIPHIPQLIL
HLSNENSNSATNCLEHIAELIHCMIFRFSGYPDLYEPIMEAVRKLPVPNEERIKVLLGQN
AWTAQKNELAAYYPRLASKSDTGKIGLLNLGNTCYMNSILQALFMASDFRHAVLSLKETH
SQPLMMKLQCLFAFLEHSQRPAISPANFLASFLPPWFTPGVQQDCSEYLKYLLDRLHEEE
KTGKRISQALAQTNSSSGVKKTMASHRTLLEQMFGGRITTKIRCLKCHSVSSREEVFTDL
SLAFPPTNEAAKQLPQPLSAGESGPQKSDLTCKVQEPQVTNSPETVRRQWRTNDPPPGET
SEFSRNVDKADPFISRLESQDENNCSIVRNKNLLSATLKEGTGGQRGSLSLSDLINHFLC
PEMLTADNKYRCDTCVSLQDAEKVVELTTGPQYLILTLLRFSFDLKAMKRRKILDNVSIP
LVLKLPIQVAGTELNDAHFGKDSRCKATKESVTYDLCSVIVHSGLSSETGHYYCYARDCL
EKDNRKPPSTGVKKLNPDKHLDLEIQWYLFNDTRVSFSSFESVSNVTSFFPKDTAYVLFY
KHRPQQAGPSSDLEAAVALSHGEVSLSKELMEAISKDNIKYLQEQEKEARNRSAYISPLL
KSPLWWQDYDKDSDDDGSSGSLGPAGGGSGSFHGLVF
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atggataagatattagaggctgtcatgcaatcttcctaccccatgcatgtgaagcagagc
ttggcccgacgggtcattgaagcttccaagcagccggtggacagcgagcagtgctggtca
atgctggaactttccaccaagctgttctttttgggggagtctcatttcagcagggaaacg
gccagggaagtccttgaagtctatggcaggtaccacccggaggagtttgaagaatttttc
aatgctagatttatcctaagtcttctgcaggaaggttacggggtgctgggaaagcggagc
acccacattttggattatgttcatcttgggctcaagtttgtgtctgacaagccctcggct
gaggacatcttcaggttactcaggatagaagttcttcgtatggtctgtgaaaggcccgga
ctgaagctctgtgttcggatcagcaacctcttagtatcctacccacaatgcatcccggct
gggaaacaccaagtgctgttctgccagcagctgatccgttctatcgggcagttccattgt
tcatctcaagcagaggaatacatagtgcagtttctggatcaggtcaacagggtctgcggc
ctgctgcaaaaaatctggagctttcagacctccttagtgcttccatgcctaaaagagctt
tttgccatcatatcttcaacagatgagtacgaagctccctccaactgcctggccagtgtg
gtacagtacatccccctggaactgatggaaggggttgtgaagaatttggccaatgcagac
agtgtctcagatatccagataatggccgccattagcagaatgattgattgggtctcgtgg
ccgctgggaaagaatatcgacaagtggataattgctttactgaaggctctggctgcagtg
aagaaatttagtatattgattgaagtttccctttccaaaatccagaaggtgttttctaag
cttgtgtaccctgtgctgcgggacggagctctttctgtgctcagatacatgttactgagt
ttccagcactcgcctgaagctttccatctgattatcccccacatcccccagctcattctc
catctctctaatgaaaactcaaactccgccaccaattgcctggagcatatcgcagagctt
atccattgtatgattttccgcttctctggataccctgacctctatgagcccatcatggaa
gcagtaaggaaacttccagtccccaatgaggagcgaataaaagtgctcctagggcagaac
gcttggacggcacagaagaacgagctggcagcttactaccccagactggcatccaaatcc
gacaccggcaagattggcctcctcaacctgggaaacacctgttacatgaacagcatcctc
caggccttattcatggcgtctgacttccggcacgcggtgctttccctgaaggagacccat
tcccagccgctgatgatgaagctgcaatgtctgttcgcttttctggagcacagtcagcgc
ccagctatctcaccggcgaatttcctggcatccttcttgcctccttggtttacaccgggt
gttcagcaggattgttctgagtatctaaagtaccttctagaccggctccatgaagaggaa
aaaacagggaagaggatctcccaagccctggcgcaaaccaacagtagctccggtgtgaag
aagacgatggccagtcacagaacattgcttgagcagatgtttggtggaagaatcacaacg
aaaatccgttgcctgaaatgtcacagtgtttcttctagggaagaagtctttacagacttg
tcacttgctttcccccccaccaatgaggcagcaaagcaactcccacagccactctcagct
ggggaaagtgggccacagaaatcagacttgacatgcaaagtccaggaacctcaagtcacc
aattctccagagacagtcagacggcagtggagaaccaatgaccctcctcccggagagact
tcagaattcagtagaaacgtagacaaggcagatcctttcatctccagactggaaagccaa
gacgagaataactgttctatcgttagaaacaagaaccttctttctgcgacattgaaagaa
gggactggaggtcagaggggttccctgtctttgtccgatttaatcaaccatttcttgtgc
ccagagatgctgaccgcggacaacaagtaccgatgcgacacctgcgtctcgctgcaggac
gctgagaaggttgtggagctgaccacaggtcctcagtatcttattttgactttgctgagg
ttctcctttgatctgaaggccatgaaacgaagaaagatccttgacaatgtgtccattcct
ttggttctcaagttacccattcaggtggcaggcacagaactcaatgatgctcactttggg
aaggacagtagatgcaaggctaccaaagagtctgtcacctacgacctctgttctgttata
gtgcattctgggttatcctcagaaacaggacactactattgttatgctagagactgcctg
gaaaaagataacaggaaaccccccagtactggggttaaaaagctaaatcctgataaacac
ctggacttggaaattcagtggtatctcttcaacgacaccagagtctcgttctcttccttc
gaatcggtcagcaacgtgacgtctttcttccccaaagacactgcttatgttcttttctac
aagcatagacctcagcaggctgggccatcgtcagacctggaggctgctgtcgccttgtcc
catggggaggtttctctaagcaaggagttaatggaagcaatttctaaagacaacatcaag
tatctgcaggagcaagaaaaggaagctcggaaccgaagtgcctacatctcccccctcctg
aagtctcccctctggtggcaagactatgacaaggacagcgatgatgatggctcctcgggg
agtttgggaccagcaggagggggttcagggtctttccacgggcttgttttttag

DBGET integrated database retrieval system