KEGG   Xenopus tropicalis (western clawed frog): 101733231Help
Entry
101733231         CDS       T01011                                 

Definition
chymotrypsinogen B2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     101733231
Peptidases [BR:xtr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101733231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 263 aa AA seqDB search
MAFLWLVSCLALATTVYGCGQPQIAPVVTGYARIVNGEEAVPGSWPWQVSLQDSTSWHFC
GGSLINNEWVVTAAHCGVSTRDKVVLGEHDRGSNVEKIQSLAVAKVFTHPQWNSNTINND
ISLIKLATPAVLGATVAPVCLANTGDDYEGGRICVTSGWGKTRYNAFTTPNQLQQTALPL
LTNDQCKSYWGNNITGTMICAGAAGSSSCMGDSGGPLVCQANDAWTLVGIVSWGSSMCST
STPAVYARVAVLRSWVDEIVASN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctttggcttgtttcctgcttggctttagccaccacagtttatggctgtggc
caacctcagatcgctccagtggttacaggttatgccaggattgtgaatggcgaggaagca
gttccagggtcttggccttggcaagtctccctgcaggattccacttcatggcacttttgc
ggaggttcccttattaacaatgagtgggttgtaactgctgctcactgtggtgtctcgacc
agagataaggtggttctcggagagcatgaccgaggctcaaacgttgaaaaaatccagtct
cttgctgttgctaaggtcttcacacacccacagtggaattccaacacaatcaacaatgat
atttccctgattaagctagccactccagctgtccttggcgcaactgtggctccagtttgt
ctggctaatactggagacgattatgaaggagggcgcatctgtgttaccagtggatgggga
aagaccagatacaatgcatttacaactccaaaccaactgcagcaaactgctctacctctg
ctgacaaacgatcagtgcaagagctactggggaaataatatcactggcacaatgatctgc
gctggtgctgctggctcctcttcctgcatgggtgattctggtggaccacttgtatgccag
gctaatgatgcatggacacttgttggcattgtgtcctggggaagcagtatgtgctcaaca
agcactccagctgtgtacgcccgtgttgcagttctccgttcttgggttgacgagattgtg
gcttccaactaa

DBGET integrated database retrieval system