KEGG   Xenopus tropicalis (western clawed frog): 394490Help
Entry
394490            CDS       T01011                                 

Gene name
cycs, cyc, cyct, hcs
Definition
cytochrome c, somatic
Orthology
K08738  
cytochrome c
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Sulfur metabolism
p53 signaling pathway
Apoptosis
Herpes simplex infection
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:xtr00920]
Cellular Processes; Cell growth and death; Apoptosis [PATH:xtr04210]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:xtr04115]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:xtr05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 105 aa AA seqDB search
MGDAEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGIVW
DEGTLLEYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKQSTSS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgctgaaaaaggcaagaaaatctttgttcagaaatgttcccagtgccacact
gtagagaaaggaggcaagcacaaaactgggcctaaccttcacggcctgtttggacgcaag
actggacaagcagaaggcttttcctatactgatgctaacaaaaataagggaattgtttgg
gatgagggtacccttctggaatatctagaaaatcctaagaagtacattcctggaacaaag
atgatctttgctggcattaagaagaagggcgagagacaagacttaatagcatatctaaaa
cagtcaaccagcagttaa

DBGET integrated database retrieval system