KEGG   Xenopus tropicalis (western clawed frog): 394490Help
Entry
394490            CDS       T01011                                 

Gene name
cycs, cyc, cyct, hcs
Definition
(RefSeq) cytochrome c, somatic
  KO
K08738  cytochrome c
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00920  Sulfur metabolism
xtr01100  Metabolic pathways
xtr04115  p53 signaling pathway
xtr04210  Apoptosis
xtr05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    394490 (cycs)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    394490 (cycs)
   04115 p53 signaling pathway
    394490 (cycs)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    394490 (cycs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Motif
Other DBs
NCBI-GeneID: 394490
NCBI-ProteinID: NP_988895
Xenbase: XB-GENE-971588
UniProt: Q6PBF4
Position
6
AA seq 105 aa AA seqDB search
MGDAEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGIVW
DEGTLLEYLENPKKYIPGTKMIFAGIKKKGERQDLIAYLKQSTSS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgggagacgctgaaaaaggcaagaaaatctttgttcagaaatgttcccagtgccacact
gtagagaaaggaggcaagcacaaaactgggcctaaccttcacggcctgtttggacgcaag
actggacaagcagaaggcttttcctatactgatgctaacaaaaataagggaattgtttgg
gatgagggtacccttctggaatatctagaaaatcctaagaagtacattcctggaacaaag
atgatctttgctggcattaagaagaagggcgagagacaagacttaatagcatatctaaaa
cagtcaaccagcagttaa

DBGET integrated database retrieval system