KEGG   Xenopus tropicalis (western clawed frog): 394558Help
Entry
394558            CDS       T01011                                 

Gene name
gpx3, gpx-p, gshpx-3, gshpx-p
Definition
glutathione peroxidase 3 (plasma) (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    394558 (gpx3)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    394558 (gpx3)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     394558 (gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 233 aa AA seqDB search
MGVKLRGLLMLPCFLAALIHAQNEMDQKSVDCYSSIDGTIYDYGATTLDGTQFIPFKAYQ
GKYILFVNVATYUGLTMQYQELNALQEELKNNNFVILGFPSNQFGMQEPGRNDEILLGLE
YVRPGGKFVPNFQLFEKGDINGRKEQKFYTFLKNSCPPVGDNFGSATNRLMWEPIKVNDV
KWNFEKFLVGPDGRPVKRWLPRTPVAQVRREIMSYMKLQPGTQRLLMLGLEQK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgggggtcaaacttagggggctattaatgctcccatgcttcctggctgctctcatccat
gcacaaaatgaaatggatcagaaatcggtggattgctacagctccatcgatgggaccatc
tatgattatggggccactacattagacgggactcagttcatccctttcaaagcgtaccaa
gggaagtacatcctgtttgtgaatgtggccacatactgaggtctcaccatgcagtaccaa
gaattgaatgcactacaagaagaattaaaaaacaataactttgtcattttgggatttcct
tctaatcagttcgggatgcaggagcctggaaggaatgatgaaattcttttgggacttgag
tatgtgcgtcccgggggaaaattcgttccaaacttccaattatttgagaagggagatatt
aatggacgaaaagaacagaaattctacacttttctcaagaactcctgcccccctgttggt
gacaactttggaagtgcaacaaatagactcatgtgggaacccataaaggtcaacgacgtc
aagtggaactttgagaagtttcttgtgggaccagacggccgcccagtgaaacgctggctc
ccccgcacacctgtcgcccaagtgagaagagagatcatgtcctacatgaagttacagccg
ggaacacaaagacttcttatgcttggattggagcaaaaataa

DBGET integrated database retrieval system