KEGG   Xenopus tropicalis (western clawed frog): 394606Help
Entry
394606            CDS       T01011                                 

Gene name
stambpl1, amsh-lp
Definition
STAM binding protein-like 1 (EC:3.1.2.15)
Orthology
K11867  
AMSH-like protease [EC:3.4.19.12]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     394606 (stambpl1)
Peptidases [BR:xtr01002]
 Metallo Peptidases
  Family M67
   394606 (stambpl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 429 aa AA seqDB search
MEQPVSSLKKLVAMPDHTDVSLSPEERVRALSKLGCNITINEDITPRRYFRSGVEMERMA
SVYLEEGNLENAFVLYNKFITLFVEKLPGHRDYQQYEIPEKQDILKKLKEVAFPRTDELK
KDLLKKYNLEYQEYLQGVHKRKAECLKKLEQQQLIEAEKKRLAQIRQQQIQTEQFSFFED
QLRKQDQVRDQLKIKDAPKVPEQIDGGMVTCISNAKSSCTEQAKRNDASIYTGQSPPVTR
ALKPAATLSAVQNEIVDGLRPVVLPRDLSQRFLQLAEANTSRGIETCGILCGKLTHDEFT
ITHVIVPKQSAGPDYCDMENVEELFNVQDQHNLLTLGWIHTHPTQTAFLSSVDLHTHCSY
QLMLPEAIAIVCSPKHNDTGIFRLTSAGMLEVSACKKKGFHPHSKEPRQFNTCRHVTVQD
AGITVLDLR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcccgtctcttccctgaagaagctggttgctatgccagatcacacggacgtg
tcgctgagcccggaggaacgtgtgcgggcactgagcaagctgggctgtaacatcaccatc
aatgaagacatcacgcccaggcgctacttccgctccggagtggagatggagagaatggcg
tctgtgtatttggaagaaggaaaccttgaaaatgcctttgttctctacaacaaatttatt
acgttatttgttgagaaactgcccggacacagagattatcagcaatatgaaatccccgaa
aagcaggatattctcaagaaattaaaggaagtcgcatttccaagaacagatgaactaaag
aaggatctgctgaagaaatacaatctggaataccaggagtacctgcaaggcgtgcacaag
cggaaggccgaatgcctgaagaagctggagcaacagcagttgatagaagcagagaagaag
cgcctggcgcaaatacgccaacagcagatccaaacggaacagttcagcttctttgaggac
cagttgcggaagcaggaccaggtgagggatcagctgaagattaaagatgcgcccaaggtg
ccggagcagatagacggcgggatggtcacgtgcatctctaacgccaaatccagctgcacc
gagcaggcgaaaaggaacgacgcctccatctacaccggccagtcccctcctgtcaccagg
gccctgaaaccagcggctacgctgagcgctgtgcagaatgaaatagtggatggcctgcgg
ccggttgtactgcccagggatctgtcccagcgatttctgcagctggccgaggccaatact
tcccgaggcatcgagacctgtgggatcctctgcggcaaactgactcacgatgaattcacc
atcacccacgtgattgtaccaaagcagtctgcggggccggactactgtgacatggagaac
gtggaggagctgtttaatgtacaggatcagcacaacctcctcaccctgggctggatccac
acgcatccgacccagacggcgttcctctccagcgtggatctgcacacccactgctcctac
cagctcatgttgccagaagccattgctatcgtttgctccccaaagcacaatgatactgga
attttccgactcactagcgccgggatgttggaggtgtctgcatgcaaaaagaaggggttc
caccctcacagcaaggagccgcgacaattcaatacctgcagacacgtgacggtacaggac
gccgggatcaccgtgctggacctgaggtga

DBGET integrated database retrieval system