KEGG   Xenopus tropicalis (western clawed frog): 394820Help
Entry
394820            CDS       T01011                                 

Definition
uncharacterized protein MGC75752
Orthology
K00522  
ferritin heavy chain [EC:1.16.3.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Porphyrin and chlorophyll metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:xtr00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 178 aa AA seqDB search
MSAQSQIRQNYHEESEAGINRIANLELQTSYVYLSLGYYFDRDDVALSKFSKYYRELSEK
KRDHAEDLLKFQNKRGGRVVLQDIKKPDADEWGNGTKAMEVALNLEKSVNQALLDLHKIA
TDHADPHMCDYLEREFLEEEVKIIKKLGDHLTNLKRVKAAEDGMGEYLFDKLTLGDSD
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcagagtcagatccgccagaactaccatgaggaaagcgaggctggaatcaac
cgcattgccaacctagagctgcagacttcctatgtctacctgtctctgggctattacttc
gatcgtgatgatgtggctctttccaagttctcaaagtactaccgtgagctatctgagaag
aagcgggatcacgctgaggatttactaaaattccagaacaagcgtggggggcgcgttgtg
ctccaagacatcaagaaacctgatgccgacgagtggggcaatgggaccaaggctatggag
gttgcactcaatcttgagaagagcgtgaaccaggctctcttggacctgcacaaaattgct
acagatcatgccgatccacatatgtgtgactatctggagcgcgagttccttgaggaggaa
gttaagatcatcaagaagctgggcgaccaccttaccaacctgaagcgcgttaaggcagct
gaagatggcatgggagaatatctctttgataagctgaccctgggagacagtgactaa

DBGET integrated database retrieval system