KEGG   Xenopus tropicalis (western clawed frog): 394820Help
Entry
394820            CDS       T01011                                 

Definition
(RefSeq) uncharacterized protein MGC75752
  KO
K00522  ferritin heavy chain [EC:1.16.3.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04216  Ferroptosis
xtr04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Cellular Processes
  Cell growth and death
   04216 Ferroptosis
    394820
   04217 Necroptosis
    394820
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.2  bacterial non-heme ferritin
     394820
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   394820
  Exosomal proteins of bladder cancer cells
   394820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ferritin Rubrerythrin
Motif
Other DBs
NCBI-GeneID: 394820
NCBI-ProteinID: NP_989212
UniProt: Q6P4N0
Position
7
AA seq 178 aa AA seqDB search
MSAQSQIRQNYHEESEAGINRIANLELQTSYVYLSLGYYFDRDDVALSKFSKYYRELSEK
KRDHAEDLLKFQNKRGGRVVLQDIKKPDADEWGNGTKAMEVALNLEKSVNQALLDLHKIA
TDHADPHMCDYLEREFLEEEVKIIKKLGDHLTNLKRVKAAEDGMGEYLFDKLTLGDSD
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcagagtcagatccgccagaactaccatgaggaaagcgaggctggaatcaac
cgcattgccaacctagagctgcagacttcctatgtctacctgtctctgggctattacttc
gatcgtgatgatgtggctctttccaagttctcaaagtactaccgtgagctatctgagaag
aagcgggatcacgctgaggatttactaaaattccagaacaagcgtggggggcgcgttgtg
ctccaagacatcaagaaacctgatgccgacgagtggggcaatgggaccaaggctatggag
gttgcactcaatcttgagaagagcgtgaaccaggctctcttggacctgcacaaaattgct
acagatcatgccgatccacatatgtgtgactatctggagcgcgagttccttgaggaggaa
gttaagatcatcaagaagctgggcgaccaccttaccaacctgaagcgcgttaaggcagct
gaagatggcatgggagaatatctctttgataagctgaccctgggagacagtgactaa

DBGET integrated database retrieval system