KEGG   Xenopus tropicalis (western clawed frog): 394825Help
Entry
394825            CDS       T01011                                 

Gene name
pfkp, pfk, pfk-c, pfk1, pfkf
Definition
phosphofructokinase, platelet (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    394825 (pfkp)
   01230 Biosynthesis of amino acids
    394825 (pfkp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    394825 (pfkp)
   00030 Pentose phosphate pathway
    394825 (pfkp)
   00051 Fructose and mannose metabolism
    394825 (pfkp)
   00052 Galactose metabolism
    394825 (pfkp)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    394825 (pfkp)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     394825 (pfkp)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     394825 (pfkp)
Messenger RNA biogenesis [BR:xtr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     394825 (pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
Position
Un
AA seq 802 aa AA seqDB search
MAQPDRKLFENLSGKGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVQAKVYFIYEGYQGMV
DGGDNIEEVSWESVSSILQVGGTVIGSARCKAFRTREGRLQAAYNLVQRGITNLCVIGGD
GSLTGANLFREEWSGLLDELMQNGKIEAEATREYAHLNIVGMVGSIDNDFCGTDMTIGTD
SALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGW
EDMMCNKLSENRARKKRLNIIIVSEGAIDCHNKAITSDMVKDLVVKRLGFDTRVTILGHV
QRGGTPSAFDRILASRMGVDCVLALLEATPETPACVVSLCGNQAVRLPLMECVQMTQEVQ
KAMDERRFDDAVRLRGRSFENNLNTYKLLSHKKNVADLPKSNFTVAVLNVGAPAAGMNAA
VRSAVRVGITEGHKMLAVNDGFEGFAKGQIKDIKWGDVGGWTGQGGSLLGTKRTLPAKYF
DKIAEQIRTHKINALLVIGGFEAYLGLMEMVEGRGKYDEFCIPMVMVPATVSNNVPGSDF
SIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEE
SFDIRELQANVEHLTEKMKTSIQRGLVLRPRLFIDQPPIQTTPRLLRNENSNENYTTDFI
YQLYSEEGRGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAVQWISKKLKETYRKGRV
FANTDDSVCLLGMRRRNLLFQPVTQLKDETDFKHRIPKEQWWLKMRPLMKILAKYKTSYD
ISDAGKLEHVNMCRRKDETGPI
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggcacagccagataggaagcttttcgagaatctgtccgggaagggcaaagccatcggg
gtgctgaccagcggaggagatgcccaaggtatgaacgcagctgtgcgcgccgtagtgcga
atgggcatctacgtacaagccaaagtgtacttcatttatgagggctaccaaggaatggtg
gatggcggagacaacattgaggaagtgtcatgggaaagcgtttctagcatcttgcaagtg
ggtgggaccgtcattggtagtgcgcgttgcaaggcattccggactcgcgaaggacgtttg
caggcagcttataaccttgttcaacgtggaattaccaatctgtgtgttattggcggtgat
ggcagtctgacaggtgctaacctgttccgtgaggaatggagcgggcttcttgatgaacta
atgcaaaatggaaaaattgaggcagaagcaaccagggaatatgcccatctgaacattgta
ggaatggtgggatctatagataatgatttctgtggaactgatatgaccattgggaccgac
tctgccctgcataggattattgaagtggttgatgctatcatgaccacagctcagagccac
cagaggacctttgtgctggaagttatgggaagacactgtgggtacctcgctctggtcagt
gccttagcttgtggggcagactgggtgtttatccctgaataccctccggaagagggatgg
gaagacatgatgtgcaacaaactgtctgagaatcgtgcaaggaagaaaaggcttaatatc
atcattgtatcagaaggagctatcgactgccataataaggcaatcacgtcagacatggtt
aaggatcttgttgtgaaacgcctggggtttgacacccgtgttacaatattgggccatgtc
caaagaggtggaaccccatcagcttttgacaggattctggcaagtcgaatgggagtggac
tgtgtgttggccctgcttgaagctacgccagaaacgccagcctgtgttgtgtcgttatgt
ggaaaccaagctgtgcgactgccccttatggaatgtgttcagatgacccaggaagtgcag
aaggccatggatgaaagaagatttgatgatgctgtaaggttacggggaaggagctttgaa
aataacctaaacacttacaagctgctctcccataagaaaaatgtagcagaccttccaaag
agtaatttcaccgtggccgttctgaatgtgggggcaccggctgcgggcatgaacgctgca
gtcagatctgcggtgagagtaggaataactgaaggccacaaaatgctagccgtcaatgat
ggttttgaaggattcgccaaggggcagattaaagacataaaatggggagatgttggtggc
tggactggtcaaggcggatctcttctgggaacaaagaggacccttcctgctaaatacttt
gacaaaattgcagagcaaatccgaacgcataaaattaacgctctccttgtcattggtgga
tttgaggcctacttgggactgatggaaatggttgagggccgagggaagtatgatgagttc
tgtatccctatggtcatggttcccgctactgtctccaacaatgtgcccggctcagatttc
agcattggtgcagatacagctctgaacactataaccgatacgtgcgatcgcatcaaacag
tcagcgagtggaaccaaacggcgggtcttcatcattgaaaccatgggtggctactgcggc
tacttggctaacatgggcggcctcgcggccggtgcagatgcggcgtacatctttgaagaa
tcctttgatattcgggagctccaggcaaatgtggaacatttaacagagaagatgaaaaca
agcatccaaagaggtctggtactgaggcctcgcctattcatagatcagcctcccattcaa
accactccccggttgttaagaaatgagaacagcaatgagaactacacgacagatttcatt
tatcagctttactcggaggaaggcagaggcgtgtttgactgcagaaagaatgtattgggc
cacatgcagcagggtggcgctccttccccgttcgacagaaacttcggcactaaaatttcc
gccaaagccgttcagtggatttccaagaagttaaaagaaacctacaggaaaggcagggta
ttcgccaacacggacgacagcgtttgcctgttaggaatgcgcaggaggaaccttcttttc
cagccagttacacaactcaaggacgaaacagacttcaagcacaggattcccaaggaacag
tggtggctgaagatgaggcctttgatgaagattctggccaagtacaagacaagctacgac
atttcagacgccgggaagctggaacacgtgaacatgtgcagacggaaagatgaaacggga
cccatctga

DBGET integrated database retrieval system