KEGG   Xenopus tropicalis (western clawed frog): 394825Help
Entry
394825            CDS       T01011                                 

Gene name
pfkp, pfk, pfk-c, pfk1, pfkf
Definition
phosphofructokinase, platelet (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:xtr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:xtr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:xtr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:xtr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:xtr00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:xtr00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 802 aa AA seqDB search
MAQPDRKLFENLSGKGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVQAKVYFIYEGYQGMV
DGGDNIEEVSWESVSSILQVGGTVIGSARCKAFRTREGRLQAAYNLVQRGITNLCVIGGD
GSLTGANLFREEWSGLLDELMQNGKIEAEATREYAHLNIVGMVGSIDNDFCGTDMTIGTD
SALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGW
EDMMCNKLSENRARKKRLNIIIVSEGAIDCHNKAITSDMVKDLVVKRLGFDTRVTILGHV
QRGGTPSAFDRILASRMGVDCVLALLEATPETPACVVSLCGNQAVRLPLMECVQMTQEVQ
KAMDERRFDDAVRLRGRSFENNLNTYKLLSHKKNVADLPKSNFTVAVLNVGAPAAGMNAA
VRSAVRVGITEGHKMLAVNDGFEGFAKGQIKDIKWGDVGGWTGQGGSLLGTKRTLPAKYF
DKIAEQIRTHKINALLVIGGFEAYLGLMEMVEGRGKYDEFCIPMVMVPATVSNNVPGSDF
SIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEE
SFDIRELQANVEHLTEKMKTSIQRGLVLRPRLFIDQPPIQTTPRLLRNENSNENYTTDFI
YQLYSEEGRGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAVQWISKKLKETYRKGRV
FANTDDSVCLLGMRRRNLLFQPVTQLKDETDFKHRIPKEQWWLKMRPLMKILAKYKTSYD
ISDAGKLEHVNMCRRKDETGPI
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggcacagccagataggaagcttttcgagaatctgtccgggaagggcaaagccatcggg
gtgctgaccagcggaggagatgcccaaggtatgaacgcagctgtgcgcgccgtagtgcga
atgggcatctacgtacaagccaaagtgtacttcatttatgagggctaccaaggaatggtg
gatggcggagacaacattgaggaagtgtcatgggaaagcgtttctagcatcttgcaagtg
ggtgggaccgtcattggtagtgcgcgttgcaaggcattccggactcgcgaaggacgtttg
caggcagcttataaccttgttcaacgtggaattaccaatctgtgtgttattggcggtgat
ggcagtctgacaggtgctaacctgttccgtgaggaatggagcgggcttcttgatgaacta
atgcaaaatggaaaaattgaggcagaagcaaccagggaatatgcccatctgaacattgta
ggaatggtgggatctatagataatgatttctgtggaactgatatgaccattgggaccgac
tctgccctgcataggattattgaagtggttgatgctatcatgaccacagctcagagccac
cagaggacctttgtgctggaagttatgggaagacactgtgggtacctcgctctggtcagt
gccttagcttgtggggcagactgggtgtttatccctgaataccctccggaagagggatgg
gaagacatgatgtgcaacaaactgtctgagaatcgtgcaaggaagaaaaggcttaatatc
atcattgtatcagaaggagctatcgactgccataataaggcaatcacgtcagacatggtt
aaggatcttgttgtgaaacgcctggggtttgacacccgtgttacaatattgggccatgtc
caaagaggtggaaccccatcagcttttgacaggattctggcaagtcgaatgggagtggac
tgtgtgttggccctgcttgaagctacgccagaaacgccagcctgtgttgtgtcgttatgt
ggaaaccaagctgtgcgactgccccttatggaatgtgttcagatgacccaggaagtgcag
aaggccatggatgaaagaagatttgatgatgctgtaaggttacggggaaggagctttgaa
aataacctaaacacttacaagctgctctcccataagaaaaatgtagcagaccttccaaag
agtaatttcaccgtggccgttctgaatgtgggggcaccggctgcgggcatgaacgctgca
gtcagatctgcggtgagagtaggaataactgaaggccacaaaatgctagccgtcaatgat
ggttttgaaggattcgccaaggggcagattaaagacataaaatggggagatgttggtggc
tggactggtcaaggcggatctcttctgggaacaaagaggacccttcctgctaaatacttt
gacaaaattgcagagcaaatccgaacgcataaaattaacgctctccttgtcattggtgga
tttgaggcctacttgggactgatggaaatggttgagggccgagggaagtatgatgagttc
tgtatccctatggtcatggttcccgctactgtctccaacaatgtgcccggctcagatttc
agcattggtgcagatacagctctgaacactataaccgatacgtgcgatcgcatcaaacag
tcagcgagtggaaccaaacggcgggtcttcatcattgaaaccatgggtggctactgcggc
tacttggctaacatgggcggcctcgcggccggtgcagatgcggcgtacatctttgaagaa
tcctttgatattcgggagctccaggcaaatgtggaacatttaacagagaagatgaaaaca
agcatccaaagaggtctggtactgaggcctcgcctattcatagatcagcctcccattcaa
accactccccggttgttaagaaatgagaacagcaatgagaactacacgacagatttcatt
tatcagctttactcggaggaaggcagaggcgtgtttgactgcagaaagaatgtattgggc
cacatgcagcagggtggcgctccttccccgttcgacagaaacttcggcactaaaatttcc
gccaaagccgttcagtggatttccaagaagttaaaagaaacctacaggaaaggcagggta
ttcgccaacacggacgacagcgtttgcctgttaggaatgcgcaggaggaaccttcttttc
cagccagttacacaactcaaggacgaaacagacttcaagcacaggattcccaaggaacag
tggtggctgaagatgaggcctttgatgaagattctggccaagtacaagacaagctacgac
atttcagacgccgggaagctggaacacgtgaacatgtgcagacggaaagatgaaacggga
cccatctga

DBGET integrated database retrieval system