KEGG   Xenopus tropicalis (western clawed frog): 394832Help
Entry
394832            CDS       T01011                                 

Gene name
hadha
Definition
hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    394832 (hadha)
   01212 Fatty acid metabolism
    394832 (hadha)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    394832 (hadha)
   00650 Butanoate metabolism
    394832 (hadha)
  Lipid metabolism
   00062 Fatty acid elongation
    394832 (hadha)
   00071 Fatty acid degradation
    394832 (hadha)
   01040 Biosynthesis of unsaturated fatty acids
    394832 (hadha)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    394832 (hadha)
   00310 Lysine degradation
    394832 (hadha)
   00380 Tryptophan metabolism
    394832 (hadha)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    394832 (hadha)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     394832 (hadha)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     394832 (hadha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 760 aa AA seqDB search
MAAARLVGVLARLGGANRTGYTCRHLSMSSALLTRTHVNYEIKDDVAVVRFNTPNSKVNT
LSKQLQTEFSDVMNEIWANDAVQSAVLISSKPGCFIAGADINMIESCKTSQEVTQLSQEG
QKMFAKLEKSPKPIVAAINGSCLGGGLEVAIACQYRVATKDKKTVLGTPEVLLGLLPGAG
GTQRLPRMVGLPTAFDMMLTGRNIRADRAKRMGLVDQLVDPLGPGLKSPEDRTIEYLEEV
AVDCARGIAKKKISLKKEKGLMQKVTDYVMSVPFVRQQIYKTVEKKVNKQTKGLYPAPLK
IIEVVRTGLDQGQEAGYLAEAQKFGELGTTPESKALIGLYHGQVICKKNKFGTPERPVQK
LAILGAGLMGAGIAQVSVDKGLKTILKDTTVEGLGRGQQQVYKGLNDKVKKKSLTSFERD
SIVSNLTGQLDYKGFETADMVIEAVFEDIRIKHKVLQEVEAVVPPHCIFASNTSALPISQ
IAAASKRPEKVIGMHYFSPVDKMQLLEIITTDKTSKDTTAAAVAVGLKQGKVIIVVKDGP
GFYTTRCLGPMMAEVVRVLQEGVDPKKLDALSTGFGFPVGASTLADEVGIDVAAHVAEDL
GKAFGERFGGGNIELLKAMVAKGFLGRKSGKGFYIYQQGVKNRSINSGTEEILEKFKLQA
KPEVSSNEDIQLRLVTRFVNEAVMCLQEGILANPVEGDIGAVFGLGFPPCLGGPFRYADA
FGAKRIVEKMRKYESVYGSQFTPCQLLLDHASDPSKKFHH
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcgcggctcgttggggttctggccaggctcggcggggctaacaggacaggt
tatacttgcaggcatctctccatgtcatcagcactactgacaagaacccacgtaaactat
gagatcaaagatgatgttgctgttgttcgatttaacacccccaattccaaggtgaacaca
ctgtccaagcagctgcagacagaattcagcgacgttatgaatgaaatctgggccaacgac
gccgtccaaagtgccgtcctaatctcttccaaaccgggctgcttcatcgctggggctgat
atcaacatgattgagtcctgtaagaccagccaggaagtcacgcagctgtcccaggaaggg
cagaaaatgtttgccaagctggagaagtcccccaaacccatagttgctgccatcaatggt
tcctgcctgggaggtggattagaggtggccattgcctgccagtacagagtggcaacgaag
gacaagaagactgttctggggaccccagaggttttacttgggttgctgcccggggcagga
ggaacacagaggctgcccagaatggtggggcttcccacagcgtttgacatgatgctgact
ggaagaaacatccgagccgacagggcaaagagaatgggattggtggatcagcttgttgat
cctctcggaccaggcctgaaaagtccagaggatagaactatcgagtacctggaagaagta
gctgtggactgtgcccgaggaatagccaagaagaagatctcattgaagaaagagaagggt
ctgatgcagaaggtcacagactatgtcatgtccgtgccgtttgtccggcaacaaatctac
aaaacagtggagaaaaaagtgaataaacagacaaagggtctttaccctgcccccttgaag
attattgaggtggtaaggactgggctggaccagggacaggaggctggctatctggccgag
gcacagaaattcggggagctgggaacgaccccagagtccaaagcactaatcgggctgtac
cacggacaggttatttgtaagaagaataagtttggcactccagaaagaccagtacagaaa
ttggctatacttggggctggccttatgggagctggcattgctcaggtctctgtggataaa
gggttaaagaccattctgaaggacacgacagtggaaggcttaggaagagggcaacaacaa
gtctacaaagggcttaatgacaaggtgaagaagaagagtctgacttcgtttgagagagac
agcattgtcagcaacctgacggggcagctggattataagggtttcgagacagccgacatg
gtgatcgaggccgtgtttgaggatatccgcattaaacacaaagttctacaggaggtggaa
gctgttgtccccccacactgtatatttgccagcaacacgtcggccctccccatctctcag
atagcagccgccagcaaaaggccagaaaaagtgatcgggatgcactatttctcccctgtg
gataagatgcagctgctggaaataatcactactgacaaaacctctaaggacaccaccgct
gccgctgtcgctgtcggcctcaagcagggcaaggtgatcattgtggtaaaggacgggcca
ggattctacactacccgctgccttggtcccatgatggctgaagttgtccgtgtcctgcag
gaaggggtagatcccaagaaactggatgccctctctaccggctttggtttcccagtaggg
gcatctactctagctgacgaggtgggcatcgacgtggcggctcacgtggctgaggacctt
ggcaaagctttcggagagcgcttcgggggcgggaacattgagctcttgaaagctatggtg
gccaaaggattcttggggcgtaaatcaggaaaaggcttttacatttatcagcagggagtg
aagaaccggtccattaactctggcactgaggagatactggagaagttcaagctacaggcc
aagcctgaagtctcctccaatgaagacatccagttgcgcttggtcactcgctttgtgaat
gaggcagtgatgtgcctgcaggagggaatcctcgctaacccagtagagggagacattggg
gctgtgtttggccttgggttccccccatgtctgggcggcccattcaggtacgccgacgcc
ttcggagcaaagcgcatagtggagaagatgcgcaagtacgagagtgtgtacggcagccag
ttcaccccgtgccagctgctgctcgaccacgccagcgaccccagcaagaagttccaccat
taa

DBGET integrated database retrieval system