KEGG   Xenopus tropicalis (western clawed frog): 394844Help
Entry
394844            CDS       T01011                                 

Gene name
dhcr7, 7-Dhcr, Xdhcr7, slos
Definition
7-dehydrocholesterol reductase (EC:1.3.1.21)
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    394844 (dhcr7)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     394844 (dhcr7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Xenbase: 
UniProt: 
Position
Un
AA seq 473 aa AA seqDB search
MGERRRANASRGDKKVANGEKPHVGQWGRAWEVDYFSLAAVLFLLAFAPLIVYYFVMSCD
QYQCALTAPVLDLYWGKAQLSDIWDKTPALTWGAAKIYIVWVSFQVFLYMLVPDILHKFV
PGYEGGVQEGARTPAGLINKYQVNGLQAWTITHLLWFANAYHFHWFSPTIIIDNWVPLLW
CANLLGYSVATFALLKAYFFPTNAHDCKFTGNFFYDYMMGIEFNPRIGKWFDFKLFFNGR
PGIVAWTLINLSYAAKQQELYGQVTNSMILVNVLQAIYVVDFFWNESWYLKTIDICHDHF
GWYLGWGDCVWLPYLYTLQGLYLVYNPVELSTATAVGVLLLGLIGYYIFRMTNHQKDLFR
RTNGNCKIWGKKPKSIECSYTSADGKRHYSKLMISGFWGVARHLNYTGDLMGSLAYCLAC
GFDHLLPYFYFTYMTILLVHRCIRDEHRCSSKYGKDWKLYTDAVPYRLLPGLF
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgggggagcgcagaagagcgaacgcgtcccggggggacaagaaagtggccaatggagaa
aagccacacgtgggccagtggggcagagcctgggaagtggattacttctcattggctgcc
gtcctgttcctattggccttcgccccgctgatcgtctactactttgtcatgtcatgtgat
cagtaccagtgcgcgctcaccgcccccgtgctggacctgtactggggcaaagcgcagctg
tccgacatctgggacaagacccccgcgctgacctggggggccgccaagatctacatagtg
tgggtctccttccaggtgttcctgtacatgttggtccctgacatcttacataagtttgtg
cccggctatgagggaggagtgcaggaaggagcgaggacccctgctggcttgatcaacaag
taccaagtgaacgggctgcaggcctggaccatcacccacctcctctggttcgccaacgcc
taccacttccactggttctccccgaccatcatcatcgacaactgggtcccgctgctgtgg
tgcgccaatctcctgggctattccgtcgccaccttcgcgctgctgaaggcctacttcttc
cccaccaatgcccacgactgcaaattcacgggcaacttcttctacgactacatgatgggc
atcgagttcaacccccgcattggaaaatggttcgacttcaagctgttcttcaatgggcgc
ccggggattgtggcctggaccctaattaacttgtcctacgcggccaaacagcaagagctc
tatgggcaggtcaccaactccatgattctggtcaatgttctccaggcaatctacgtggtg
gactttttctggaacgaatcttggtacctgaagactattgacatttgccacgaccacttt
ggctggtatctaggatggggagattgcgtctggctgccctacctttataccctacagggt
ctgtatctggtgtacaacccggtggagctctctaccgccaccgccgtcggagtccttctg
ctcggtctgattggctactacatcttcagaatgaccaatcaccagaaagacctcttccga
cgcaccaacggcaactgcaagatctgggggaagaagcccaaatccatcgaatgttcctac
acgtcggcggacggcaagcgccattacagcaagctgatgatttcggggttctggggggtg
gccaggcatttaaactacaccggggatttaatggggtccctggcctattgcctggcctgt
ggcttcgaccacctactgccctacttctacttcacctacatgaccatcttgttggtccat
cgctgtatacgggacgagcaccgctgctccagcaaatacgggaaggactggaagctctac
accgacgccgtgccctaccggctgctccccggactcttctaa

DBGET integrated database retrieval system