KEGG   Xenopus tropicalis (western clawed frog): 394905Help
Entry
394905            CDS       T01011                                 

Gene name
lypla2
Definition
(RefSeq) lysophospholipase II
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    394905 (lypla2)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     394905 (lypla2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Hydrolase_4 Abhydrolase_3 DLH FSH1 Abhydrolase_1 Abhydrolase_6 Cutinase DUF2974 Lipase_3
Motif
Other DBs
NCBI-GeneID: 394905
NCBI-ProteinID: NP_989287
Xenbase: XB-GENE-951391
UniProt: Q6P346
Position
2
AA seq 231 aa AA seqDB search
MCGNNMSVPLLTDAVTVPAGERETGAVIFLHGLGDTGHGWAEALSAIRLPHVKYICPHAP
RIPVTLNMKMVMPAWFDLMGLSPDAPEDEAGIKKAAESIKTIIEHEVKNGIPANRIVLGG
FSQGGALSLYTALSCQHKLAGVIGLSCWLPLHKTFPQAASGVNKEISVLQCHGEADPMIP
VRFGNLTSEKLKSVLNPSKVQFKSYPGVMHSTNQEEMMAVKDFLEKVLPRV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggaataacatgtctgtaccgctactcaccgatgccgtgaccgtgcctgcgggg
gaacgggagaccggggcggtgatattccttcatggacttggtgacacaggacatggctgg
gccgaggcactgtcagccatcagactgccacatgtgaagtatatttgcccacatgcgccc
cgtattccagtcactctgaacatgaagatggtgatgcctgcatggtttgatctgatgggt
ctgagtcctgatgctcctgaagatgaggcgggaatcaagaaggcagcagagagcattaag
actatcattgagcatgaagtaaagaatggaatcccggccaataggattgtcttgggtggt
ttctctcagggaggggctctttctctgtacacagccctcagctgccaacacaaactggct
ggagtaattggactaagctgttggttgcctcttcataagacattccctcaggctgcaagt
ggtgtaaataaggaaatatctgttctgcaatgtcatggagaagctgaccctatgattcct
gttcgctttggaaacctcacctcagagaagctgaaatcggtgttgaacccttctaaagtc
cagttcaaatcataccctggagtcatgcatagcaccaatcaggaggaaatgatggcagtg
aaagatttcttggagaaagtgctcccacgagtgtaa

DBGET integrated database retrieval system